• Gene id: 348235

Gene Summary

• Gene Symbol: SKA2   Gene   UCSC   Ensembl
• Aliases: FAM33A
• Gene name: spindle and kinetochore associated complex subunit 2
• Alternate names: spindle and kinetochore-associated protein 2, family with sequence similarity 33, member A, spindle and KT (kinetochore) associated 2,
• Gene location: 17q22 (59155185: 59109856)     Exons: 4     NC_000017.11
• OMIM: 616674

Protein Summary

• Protein general information: Q8WVK7  
  • Name: Spindle and kinetochore associated protein 2 (Protein FAM33A)
  • Length: 121  
  • Mass: 14188
• Sequence:

  MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESK
  SRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL

• Structural information:
  • Interpro: IPR026762  IPR042091  
  • PDB: 4AJ5
  • PDBsum: 4AJ5
  • STRING: ENSP00000333433
• Other Databases: GeneCards:  SKA2  Malacards:  SKA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IBA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0007059	chromosome segregation	IBA	biological process
GO:0005876	spindle microtubule	IBA	cellular component
GO:0031110	regulation of microtubule polymerization or depolymerization	IDA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IDA	cellular component
GO:0000940	condensed chromosome outer kinetochore	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0051301	cell division	IMP	biological process
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000940	condensed chromosome outer kinetochore	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005876	spindle microtubule	IEA	cellular component
GO:0007059	chromosome segregation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005819	spindle	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)