• Gene id: 3482

Gene Summary

• Gene Symbol: IGF2R   Gene   UCSC   Ensembl
• Aliases: CD222, CI-M6PR, CIMPR, M6P-R, M6P/IGF2R, MPR 300, MPR1, MPR300, MPRI
• Gene name: insulin like growth factor 2 receptor
• Alternate names: cation-independent mannose-6-phosphate receptor, 300 kDa mannose 6-phosphate receptor, CI Man-6-P receptor, IGF-II receptor, M6P/IGF2 receptor, insulin-like growth factor II receptor,
• Gene location: 6q25.3 (159969098: 160111503)     Exons: 48     NC_000006.12
• Gene summary(Entrez): This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate. The binding sites for each ligand are located on different segments of the protein. This receptor has various functions, including in the intracellular trafficking
• OMIM: 147280

Protein Summary

• Protein general information: P11717  
  • Name: Cation independent mannose 6 phosphate receptor (CI Man 6 P receptor) (CI MPR) (M6PR) (300 kDa mannose 6 phosphate receptor) (MPR 300) (Insulin like growth factor 2 receptor) (Insulin like growth factor II receptor) (IGF II receptor) (M6P/IGF2 receptor) (
  • Length: 2491  
  • Mass: 274,375
• Sequence:

  MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKNNVLYKINICGSVDIV
  QCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQGTNHRVQSSIAFLCGKTLGTPEFVTATECV
  HYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQL
  RACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
  TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYLFYLNVCGETEIQFCN
  KKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDECSSGFQRMSVINFECNKTAGNDGKGTPVFTG
  EVDCTYFFTWDTEYACVKEKEDLLCGATDGKKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQE
  GKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
  GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFYINVCGPVSVSPCQPD
  SGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERHTPRATLITFLCDRDAGVGFPEYQEEDNSTY
  NFRWYTSYACPEEPLECVVTDPSTLEQYDLSSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNR
  YASACQMKYEKDQGSFTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
  HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSGIGKIFMFNVCGTMPV
  CGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFITLTYKGPLSAKGTADAFIVRFVCNDDVYSGP
  LKFLHQDIDSGQGIRNTYFEFETALACVPSPVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVC
  NPLPYIPGCQGSAVGSCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
  LQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDK
  SKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDRGTQRPVFLKETSDCS
  YLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGTEPCPPEAA
  ACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAW
  PTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVG
  KANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEARPTNRPMLISLDKQTCTLFFSWHTPLACEQAT
  ECSVRNGSSIVDLSPLIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIG
  RVAGPPILNPIANEIYLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVR
  MDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLD
  YRHQDEAVVLSYVNGDRCPPETDDGVPCVFPFIFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRT
  SSIIFKCDEDEDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYY
  INLCQKIYKGPLGCSERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV
  GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEI
  QLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDP
  LVEDGIPEFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALL
  LYKKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALS
  SLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDRVGLVRGEKARKGKSSSAQQKTVSST
  KLVSFHDDSDEDLLHI

• Structural information:
  • Protein Domains: Fibronectin (1898-1944)
  • Interpro: IPR000479  IPR000562  IPR036943  IPR013806  IPR009011  
  • Prosite: PS00023 PS51092
  • CDD: cd00062
  • PDB: 1E6F 1GP0 1GP3 1GQB 1JPL 1JWG 1LF8 2CNJ 2L29 2L2A 2M68 2M6T 2V5N 2V5O 2V5P 5IEI
  • PDBsum: 1E6F 1GP0 1GP3 1GQB 1JPL 1JWG 1LF8 2CNJ 2L29 2L2A 2M68 2M6T 2V5N 2V5O 2V5P 5IEI
  • DIP: 6027
  • STRING: ENSP00000349437
• Other Databases: GeneCards:  IGF2R  Malacards:  IGF2R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001889	liver development	IEA	biological process
GO:0001948	glycoprotein binding	IDA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0001972	retinoic acid binding	IEA	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	TAS	molecular function
GO:0005215	transporter activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005537	mannose binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005641	nuclear envelope lumen	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	IMP	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0030118	clathrin coat	IEA	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031995	insulin-like growth factor II binding	IEA	molecular function
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001889	liver development	IEA	biological process
GO:0001948	glycoprotein binding	IEA	molecular function
GO:0001948	glycoprotein binding	IDA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0001972	retinoic acid binding	IEA	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	TAS	molecular function
GO:0005215	transporter activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005537	mannose binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005641	nuclear envelope lumen	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	IMP	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006810	transport	IEA	biological process
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0030118	clathrin coat	IEA	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031995	insulin-like growth factor II binding	IEA	molecular function
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001948	glycoprotein binding	IDA	molecular function
GO:0004872	receptor activity	TAS	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	IMP	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005802	trans-Golgi network	IMP	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04142	Lysosome

Diseases

Associated diseases	References
Cancer	GAD: 12543777
Cancer (Adenocarcinoma)	GAD: 19626700
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 18562769
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 20453000
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18636124
Cancer (oral)	GAD: 12543777
Cancer (breast)	GAD: 19435860
Cancer (Hepatocellular)	GAD: 20119675
Cancer (leukemia)	GAD: 19074885
Cancer (hepatocellular)	KEGG: H00048
Intrauterine growth retardation	GAD: 15506681
Multiple sclerosis	GAD: 19010793
Celiac disease	GAD: 19240061
Diabetes	GAD: 15181035
Bone diseases	GAD: 19453261
Alzheimer's disease	GAD: 19141999
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Diminished ovarian reserve (DOR)	INFBASE: 21846690
Polycystic ovary syndrome (PCOS)	INFBASE: 22951915
Premature ovarian failure (POF)	INFBASE: 24014609
Unexplained infertility	INFBASE: 15130350
Male factor infertility	MIK: 15130350
Male factor infertility	MIK: 23539881
Female infertility	INFBASE: 24014609
Chorioamnionitis	GAD: 20452482
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 23539881
May be involved in membrane trafficking and/or acrosomal shaping during spermiogenesis	MIK: 12950108
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23539881	Male infertility	IGF2 ApaI, IGF2R (Gly1619Arg)	Croatia n	211 (98 Croatian men with idiopathic infertility, 113 fertile men)	Male infertility	IGF2 IGF2R
15130350	Unexplained infertility, male factor infertility			58 (38 patients with unexplained infertility, 20 patients with men factor infertility or normal volunteer women as controls )	Male infertility	IGF-II IGF-IR and IGF-IIR
12950108	May be involved in membrane trafficking and/or acrosomal shaping during spermiogenesis				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray