• Gene id: 348180

Gene Summary

• Gene Symbol: CTU2   Gene   UCSC   Ensembl
• Aliases: C16orf84, MFRG, NCS2, UPF0432
• Gene name: cytosolic thiouridylase subunit 2
• Alternate names: cytoplasmic tRNA 2-thiolation protein 2, cytosolic thiouridylase subunit 2 homolog,
• Gene location: 16q24.3 (88706480: 88715395)     Exons: 15     NC_000016.10
• Gene summary(Entrez): This gene encodes a protein which is involved in the post-transcriptional modification of transfer RNAs (tRNAs). The encoded protein plays a role in thiolation of uridine residue present at the wobble position in a subset of tRNAs, resulting in enhanced c
• OMIM: 610300

Protein Summary

• Protein general information: Q2VPK5  
  • Name: Cytoplasmic tRNA 2 thiolation protein 2 (Cytosolic thiouridylase subunit 2)
  • Length: 515  
  • Mass: 56107
• Sequence:

  MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFRAMLGKNRLIFPGEKV
  LLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALE
  EVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDPQNLARPPAPAQTEAL
  SQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLALGRGAFLAWDTGFSDERHGD
  VVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFILRLQTQFPSTVSTVYRTSEKLVKGP
  RDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSPIPLTETRTPPGPCCSPGVGWAQRCGQGACR
  REDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLRTQRAWGLQEIRDCLIEDSDDEAGQS

• Structural information:
  • Interpro: IPR019407  
  • DIP: 48633
  • STRING: ENSP00000388320
• Other Databases: GeneCards:  CTU2  Malacards:  CTU2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002143	tRNA wobble position uridine thiolation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0016783	sulfurtransferase activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000049	tRNA binding	IEA	molecular function
GO:0034227	tRNA thio-modification	IEA	biological process
GO:0002098	tRNA wobble uridine modification	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006400	tRNA modification	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034227	tRNA thio-modification	IEA	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0032447	protein urmylation	IEA	biological process
GO:0002098	tRNA wobble uridine modification	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0002098	tRNA wobble uridine modification	NAS	biological process
GO:0034227	tRNA thio-modification	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04122	Sulfur relay system

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq