• Gene id: 3481

Gene Summary

• Gene Symbol: IGF2   Gene   UCSC   Ensembl
• Aliases: C11orf43, GRDF, IGF-II, PP9974
• Gene name: insulin like growth factor 2
• Alternate names: insulin-like growth factor II, T3M-11-derived growth factor, insulin-like growth factor 2 (somatomedin A), insulin-like growth factor type 2, preptin,
• Gene location: 11p15.5 (2149602: 2129111)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms
• OMIM: 147470

Protein Summary

• Protein general information: P01344  
  • Name: Insulin like growth factor II (IGF II) (Somatomedin A) (T3M 11 derived growth factor) [Cleaved into: Insulin like growth factor II; Insulin like growth factor II Ala 25 Del; Preptin]
  • Length: 180  
  • Mass: 20,140
• Sequence:

  MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSC
  DLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFR
  EAKRHRPLIALPTQDPAHGGAPPEMASNRK

• Structural information:
  • Interpro: IPR022334  IPR013576  IPR016179  IPR022350  IPR036438   IPR022353  IPR022352  
  • Prosite: PS00262
  • PDB: 1GF2 1IGL 2L29 2V5P 3E4Z 3KR3 5L3L 5L3M 5L3N
  • PDBsum: 1GF2 1IGL 2L29 2V5P 3E4Z 3KR3 5L3L 5L3M 5L3N
  • DIP: 29508
  • STRING: ENSP00000391826
• Other Databases: GeneCards:  IGF2  Malacards:  IGF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system development	TAS	biological process
GO:0001503	ossification	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006349	regulation of gene expression by genetic imprinting	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IC	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0030546	receptor activator activity	ISS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	ISS	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043539	protein serine/threonine kinase activator activity	ISS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:2000273	positive regulation of receptor activity	IEA	biological process
GO:2000467	positive regulation of glycogen (starch) synthase activity	ISS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001503	ossification	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	TAS	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006349	regulation of gene expression by genetic imprinting	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IC	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0030546	receptor activator activity	ISS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	ISS	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043539	protein serine/threonine kinase activator activity	ISS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045953	negative regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:2000273	positive regulation of receptor activity	IEA	biological process
GO:2000467	positive regulation of glycogen (starch) synthase activity	ISS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	TAS	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006349	regulation of gene expression by genetic imprinting	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IC	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0030546	receptor activator activity	ISS	molecular function
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	ISS	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0043085	positive regulation of catalytic activity	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043539	protein serine/threonine kinase activator activity	ISS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	ISS	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:2000467	positive regulation of glycogen (starch) synthase activity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05200	Pathways in cancer
hsa05205	Proteoglycans in cancer
hsa05225	Hepatocellular carcinoma

Diseases

Associated diseases	References
Cancer	GAD: 19692168
Cancer (Adenocarcinoma)	GAD: 19064563
Cancer (bladder)	GAD: 19692168
Cancer (glaucoma)	GAD: 14614750
Cancer (Hepatocellular)	GAD: 20119675
Cancer (leiomyoma)	GAD: 20651370
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18636124
Adrenal carcinoma	KEGG: H00033
Cancer (brain)	GAD: 18562769
Cancer (endometrial)	GAD: 21078522
Cancer (esophageal)	GAD: 20453000
Cancer (melanoma)	GAD: 20483645
Cancer (oral)	GAD: 15970649
Cancer (prostate)	GAD: 12610512
Cancer (stomach)	GAD: 17972051
Cancer (breast)	GAD: 19124506
Cancer (epithelial ovarian)	GAD: 19064572
Hypertension	GAD: 20057340
Atherosclerosis	GAD: 19948975
Beckwith-Wiedemann syndrome	KEGG: H00713
Russell-Silver syndrome	KEGG: H00711
Glaucoma	GAD: 14614750
Insulin resistance	GAD: 19421925
Diabetes	GAD: 12732844
Obesity	GAD: 12075589
Bone diseases	GAD: 19453261
Alzheimer's disease	GAD: 12111440
Parkinson disease	GAD: 18085551
Anorexia nervosa	GAD: 17440932
Bulimia	GAD: 20468064
Eating disorders	GAD: 16330588
Anorexia nervosa	GAD: 17440932
Autism	GAD: 19598235
Chronic renal failure	GAD: 21085059
Pregnancy loss	GAD: 18573128
Diminished ovarian reserve (DOR)	INFBASE: 21846690
Embryo implantation	INFBASE: 12596304
Endometriosis	INFBASE: 19055724
Female infertility	INFBASE: 8654631
Polycystic ovary syndrome (PCOS)	INFBASE: 21824047
Abnormal spermatogenesis	MIK: IGF2
Male factor infertility	MIK: 19880108
Oligoasthenoteratozoospermia	MIK: 19584898
Unexplained infertility	MIK: 15130350
Oligozoospermia	MIK: 19880108
Congenital adrenal hyperplasia	GAD: 19039234
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 21674046
Male infertility	MIK: 23539881
Oligoasthenoteratozoospermia (OAT)	MIK: 19584898
Oligozoospermia	MIK: 19880108
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19880108	Male factor infertility			25 (10 oligozoospermic, 10 abnormal protamine replacement patients, 5 known fertile donors)	Male infertility	LIT1 MEST SNRPN PLAGL1 PEG3 H19 and IGF2
23539881	Male infertility	IGF2 ApaI, IGF2R (Gly1619Arg)	Croatia n	211 (98 Croatian men with idiopathic infertility, 113 fertile men)	Male infertility	IGF2 IGF2R
19880108	Oligozoospermic				Male infertility	LIT1 MEST SNRPN PLAGL1 PEG3 H19 and IGF2
19878521	Idiopathic male infertility	Aberrant imprinting		181 (148 idiopathic infertile men, 33 normozoospermic controls)	Male infertility	IGF2/H19 ICR1 MEST
19584898	Oligo-astheno-teratozoospermia (OAT)	IGF2 DMR2		41 (19 teratozoospermia, 22 OAT)	Male infertility
15130350	Unexplained infertility, male factor infertility			58 (38 patients with unexplained infertility, 20 patients with men factor infertility or normal volunteer women as controls )	Male infertility	IGF-II IGF-IR and IGF-IIR
	Abnormal spermatogenesis			24 (5 with anejaculation, 5 with secondary obstructive azoospermia, 5 with primary obstructive azoospermia, 9 with secretory azoospermia due to hypospermatogenesis)	Male infertility	MEST IGF2
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray