• Gene id: 3480

Gene Summary

• Gene Symbol: IGF1R   Gene   UCSC   Ensembl
• Aliases: CD221, IGFIR, IGFR, JTK13
• Gene name: insulin like growth factor 1 receptor
• Alternate names: insulin-like growth factor 1 receptor, IGF-I receptor, soluble IGF1R variant 1, soluble IGF1R variant 2,
• Gene location: 15q26.3 (98648538: 98964529)     Exons: 26     NC_000015.10
• Gene summary(Entrez): This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It
• OMIM: 147370

Protein Summary

• Protein general information: P08069  
  • Name: Insulin like growth factor 1 receptor (EC 2.7.10.1) (Insulin like growth factor I receptor) (IGF I receptor) (CD antigen CD221) [Cleaved into: Insulin like growth factor 1 receptor alpha chain; Insulin like growth factor 1 receptor beta chain]
  • Length: 1367  
  • Mass: 154,793
• Sequence:

  MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRF
  PKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLC
  YLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACT
  ENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
  GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELE
  NFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAF
  NPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTV
  YYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
  ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYAD
  GTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTM
  SSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFART
  MPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
  YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYAS
  VNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
  ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAY
  LNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
  VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFR
  EVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMN
  GGRKNERALPLPQSSTC

• Structural information:
  • Protein Domains: Fibronectin (491-609)
    Fibronectin (610-708)
    Fibronectin (735-828)
    (834-927)
  • Interpro: IPR003961  IPR036116  IPR006211  IPR006212  IPR009030   IPR013783  IPR011009  IPR000719  IPR017441  IPR000494  IPR036941  IPR001245  IPR008266  IPR020635  IPR016246  IPR002011  
  • Prosite: PS50853 PS00107 PS50011 PS00109 PS00239
  • CDD: cd00063
  • PDB: 1IGR 1JQH 1K3A 1M7N 1P4O 2OJ9 2ZM3 3D94 3F5P 3I81 3LVP 3LW0 3NW5 3NW6 3NW7 3O23 3QQU 4D2R 4XSS 5FXQ 5FXR 5FXS 5HZN
  • PDBsum: 1IGR 1JQH 1K3A 1M7N 1P4O 2OJ9 2ZM3 3D94 3F5P 3I81 3LVP 3LW0 3NW5 3NW6 3NW7 3O23 3QQU 4D2R 4XSS 5FXQ 5FXR 5FXS 5HZN
  • DIP: 476
  • STRING: ENSP00000268035
• Other Databases: GeneCards:  IGF1R  Malacards:  IGF1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IMP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	IDA	molecular function
GO:0005158	insulin receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0006955	immune response	IMP	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IC	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IPI	molecular function
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0043559	insulin binding	IPI	molecular function
GO:0043560	insulin receptor substrate binding	IPI	molecular function
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051389	inactivation of MAPKK activity	IDA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IMP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	TAS	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	IDA	molecular function
GO:0005158	insulin receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006955	immune response	IMP	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IC	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IPI	molecular function
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043548	phosphatidylinositol 3-kinase binding	IEA	molecular function
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0043559	insulin binding	IPI	molecular function
GO:0043560	insulin receptor substrate binding	IEA	molecular function
GO:0043560	insulin receptor substrate binding	IPI	molecular function
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051389	inactivation of MAPKK activity	IDA	biological process
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IMP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	TAS	molecular function
GO:0005010	insulin-like growth factor-activated receptor activity	IDA	molecular function
GO:0005158	insulin receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005520	insulin-like growth factor binding	IDA	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0006955	immune response	IMP	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008284	positive regulation of cell proliferation	TAS	biological process
GO:0008286	insulin receptor signaling pathway	TAS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IC	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031994	insulin-like growth factor I binding	IDA	molecular function
GO:0031994	insulin-like growth factor I binding	IPI	molecular function
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0038083	peptidyl-tyrosine autophosphorylation	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043548	phosphatidylinositol 3-kinase binding	IPI	molecular function
GO:0043559	insulin binding	IPI	molecular function
GO:0043560	insulin receptor substrate binding	IPI	molecular function
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051389	inactivation of MAPKK activity	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04068	FoxO signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04152	AMPK signaling pathway
hsa04150	mTOR signaling pathway
hsa04144	Endocytosis
hsa04140	Autophagy - animal
hsa04114	Oocyte meiosis
hsa04510	Focal adhesion
hsa04520	Adherens junction
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04913	Ovarian steroidogenesis
hsa04914	Progesterone-mediated oocyte maturation
hsa04730	Long-term depression
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05205	Proteoglycans in cancer
hsa05225	Hepatocellular carcinoma
hsa05214	Glioma
hsa05218	Melanoma
hsa05215	Prostate cancer
hsa05224	Breast cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer	GAD: 19950226
Cancer (Adenocarcinoma)	GAD: 19679045
Cancer (Adenoma)	GAD: 20580999
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 18562769
Cancer (colon)	GAD: 18992263
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 20453000
Cancer (head and neck)	GAD: 19584075
Cancer (Hepatocellular)	GAD: 20119675
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18636124
Cancer (myeloma)	GAD: 19124510
Cancer (ovarian)	GAD: 19950226
Cancer (prostate)	GAD: 17164371
Cancer (breast)	GAD: 17063263
Malignant mesothelioma	KEGG: H00015
Synovial sarcoma	KEGG: H00050
Cancer (colorectal)	GAD: 18031946
Cancer (Squamous cell)	GAD: 19812598
Cancer (stomach)	GAD: 17972051
Brain ischemia	GAD: 18477064
Hypertension	GAD: 19330903
Cardiovascular disease	GAD: 21046444
Intrauterine growth retardation	GAD: 19658040
Retinopathy	GAD: 16362313
Diabetes	GAD: 15127203
Obesity	GAD: 19582762
Bone diseases	GAD: 19453261
Spinal diseases	GAD: 18469701
Alzheimer's disease	GAD: 19141999
Schizophrenia	GAD: 17044098
Dementia	GAD: 16983186
Chronic renal failure	GAD: 21085059
Abortion	GAD: 20587610
Precocious puberty	GAD: 17442315
Adenomyosis	INFBASE: 9476071
Polycystic ovary syndrome (PCOS)	INFBASE: 9642371
Diminished ovarian reserve (DOR)	INFBASE: 21846690
Embryo implantation	INFBASE: 12596304
Endometriosis	INFBASE: 9049281
Male factor infertility	MIK: 15130350
Human sperm capacitation	MIK: 15820831
Unexplained infertility	MIK: 15130350
Chorioamnionitis	GAD: 20452482
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Growth delay due to insulin-like growth factor I resistance	KEGG: H01274
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Altered the morphology of cultured Sertoli cells and decreased lactate and transferrin secretions	MIK: 17761895
Asthenozoospermia	MIK: 26626315
Cryptorchidism	MIK: 28606200
Human sperm capacitation	MIK: 15820831
Unexplained infertility	MIK: 15130350
Male infertility	MIK: 15130350

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15820831	Human sperm capacitation				Male infertility
15130350	Unexplained infertility, male factor infertility			58 (38 patients with unexplained infertility, 20 patients with men factor infertility or normal volunteer women as controls )	Male infertility	IGF-II IGF-IR and IGF-IIR
17761895	Altered the morphology of cultured Sertoli cells and decreased lactate and transferrin secretions				Male infertility
25693802	Regulation of sperm capacitation				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq