• Gene id: 347902

Gene Summary

• Gene Symbol: AMIGO2   Gene   UCSC   Ensembl
• Aliases: ALI1, AMIGO-2, DEGA
• Gene name: adhesion molecule with Ig like domain 2
• Alternate names: amphoterin-induced protein 2, alivin 1, amphoterin induced gene 2, differentially expressed in gastric adenocarcinoma, differentially expressed in gastric adenocarcinomas, transmembrane protein AMIGO2,
• Gene location: 12q13.11 (47079958: 47075706)     Exons: 3     NC_000012.12
• OMIM: 616965

Protein Summary

• Protein general information: Q86SJ2  
  • Name: Amphoterin induced protein 2 (AMIGO 2) (Alivin 1) (Differentially expressed in gastric adenocarcinomas) (DEGA)
  • Length: 522  
  • Mass: 57934
  • Tissue specificity: Highest levels in breast, ovary, cervix, and uterus. Lower levels in lung, colon, and rectum. Differentially expressed in 56% of thyroid, 57% of pancreatic and 45% of stomach cancers. {ECO
• Sequence:

  MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLSKVPGNLFRLIKRLDL
  SYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQELKVLEVLLLYN
  NHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYL
  HGNPFVCDCSLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHEA
  QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNET
  VDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLTPCPCKCKTKRQKNMLHQSNAHSSILSPGPA
  SDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKSTRGKSDSDSVNSVFSDTPFVAST

• Structural information:
  • Protein Domains: (40..6-)
    (/note="LRRNT-)
    (228..28-)
    (/note="LRRCT-)
    (289..37-)
    (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR031283  IPR031286  IPR000483  IPR007110  IPR036179   IPR013783  IPR003599  IPR013151  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50835 PS51450
  • STRING: ENSP00000266581
• Other Databases: GeneCards:  AMIGO2  Malacards:  AMIGO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007420	brain development	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	ISS	biological process
GO:0043069	negative regulation of programmed cell death	ISS	biological process
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process

Diseases

Associated diseases	References
Gastric adenocarcinoma	PMID:15107827
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray