• Gene id: 3479

Gene Summary

• Gene Symbol: IGF1   Gene   UCSC   Ensembl
• Aliases: IGF-I, IGFI, MGF
• Gene name: insulin like growth factor 1
• Alternate names: insulin-like growth factor I, insulin-like growth factor 1 (somatomedin C), insulin-like growth factor IB, mechano growth factor, somatomedin-C,
• Gene location: 12q23.2 (102481838: 102395859)     Exons: 7     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and sec
• OMIM: 147440

Protein Summary

• Protein general information: P05019  
  • Name: Insulin like growth factor I (IGF I) (Mechano growth factor) (MGF) (Somatomedin C)
  • Length: 195  
  • Mass: 21,841
• Sequence:

  MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNK
  PTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
  GWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

• Structural information:
  • Interpro: IPR022341  IPR016179  IPR022350  IPR036438  IPR022353   IPR022352  
  • Prosite: PS00262
  • PDB: 1B9G 1BQT 1GF1 1GZR 1GZY 1GZZ 1H02 1H59 1IMX 1PMX 1TGR 1WQJ 2DSP 2DSQ 2DSR 2GF1 3GF1 3LRI 4XSS
  • PDBsum: 1B9G 1BQT 1GF1 1GZR 1GZY 1GZZ 1H02 1H59 1IMX 1PMX 1TGR 1WQJ 2DSP 2DSQ 2DSR 2GF1 3GF1 3LRI 4XSS
  • DIP: 41933 6021
  • STRING: ENSP00000302665
• Other Databases: GeneCards:  IGF1  Malacards:  IGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001775	cell activation	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IDA	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005179	hormone activity	IDA	molecular function
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005614	interstitial matrix	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008283	cell proliferation	IMP	biological process
GO:0008283	cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009408	response to heat	IDA	biological process
GO:0009441	glycolate metabolic process	TAS	biological process
GO:0010468	regulation of gene expression	IMP	biological process
GO:0010560	positive regulation of glycoprotein biosynthetic process	IMP	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IDA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014834	skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IDA	biological process
GO:0014896	muscle hypertrophy	IMP	biological process
GO:0014904	myotube cell development	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016942	insulin-like growth factor binding protein complex	IC	cellular component
GO:0030166	proteoglycan biosynthetic process	IDA	biological process
GO:0030166	proteoglycan biosynthetic process	IMP	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031000	response to caffeine	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0032148	activation of protein kinase B activity	IMP	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0033160	positive regulation of protein import into nucleus, translocation	IDA	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0035630	bone mineralization involved in bone maturation	IDA	biological process
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0040014	regulation of multicellular organism growth	IEP	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045445	myoblast differentiation	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IDA	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045821	positive regulation of glycolytic process	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050974	detection of mechanical stimulus involved in sensory perception	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051450	myoblast proliferation	IDA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0060283	negative regulation of oocyte development	IMP	biological process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological process
GO:0070382	exocytic vesicle	ISS	cellular component
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0071257	cellular response to electrical stimulus	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:1904075	positive regulation of trophectodermal cell proliferation	IMP	biological process
GO:1904193	negative regulation of cholangiocyte apoptotic process	IEA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001775	cell activation	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	IEA	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IDA	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IDA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005496	steroid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005614	interstitial matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008283	cell proliferation	IMP	biological process
GO:0008283	cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009408	response to heat	IDA	biological process
GO:0009441	glycolate metabolic process	TAS	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0010468	regulation of gene expression	IMP	biological process
GO:0010560	positive regulation of glycoprotein biosynthetic process	IMP	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IDA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014834	skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IDA	biological process
GO:0014896	muscle hypertrophy	IMP	biological process
GO:0014904	myotube cell development	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016942	insulin-like growth factor binding protein complex	IC	cellular component
GO:0030166	proteoglycan biosynthetic process	IDA	biological process
GO:0030166	proteoglycan biosynthetic process	IMP	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031000	response to caffeine	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0032148	activation of protein kinase B activity	IMP	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0033160	positive regulation of protein import into nucleus, translocation	IDA	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0035630	bone mineralization involved in bone maturation	IDA	biological process
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0040014	regulation of multicellular organism growth	IEP	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045445	myoblast differentiation	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IDA	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045821	positive regulation of glycolytic process	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0050974	detection of mechanical stimulus involved in sensory perception	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051450	myoblast proliferation	IDA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0060283	negative regulation of oocyte development	IMP	biological process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological process
GO:0070382	exocytic vesicle	ISS	cellular component
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0071257	cellular response to electrical stimulus	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:1904075	positive regulation of trophectodermal cell proliferation	IMP	biological process
GO:1904193	negative regulation of cholangiocyte apoptotic process	IEA	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0001775	cell activation	IDA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005158	insulin receptor binding	IPI	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IDA	molecular function
GO:0005159	insulin-like growth factor receptor binding	IMP	molecular function
GO:0005159	insulin-like growth factor receptor binding	IPI	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005179	hormone activity	IDA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0008283	cell proliferation	IMP	biological process
GO:0008283	cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009408	response to heat	IDA	biological process
GO:0009441	glycolate metabolic process	TAS	biological process
GO:0010468	regulation of gene expression	IMP	biological process
GO:0010560	positive regulation of glycoprotein biosynthetic process	IMP	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IDA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014834	skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration	IDA	biological process
GO:0014896	muscle hypertrophy	IMP	biological process
GO:0014904	myotube cell development	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016942	insulin-like growth factor binding protein complex	IC	cellular component
GO:0030166	proteoglycan biosynthetic process	IDA	biological process
GO:0030166	proteoglycan biosynthetic process	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0032148	activation of protein kinase B activity	IMP	biological process
GO:0033160	positive regulation of protein import into nucleus, translocation	IDA	biological process
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IDA	biological process
GO:0035630	bone mineralization involved in bone maturation	IDA	biological process
GO:0035867	alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	cellular component
GO:0040014	regulation of multicellular organism growth	IEP	biological process
GO:0042104	positive regulation of activated T cell proliferation	IDA	biological process
GO:0042523	positive regulation of tyrosine phosphorylation of Stat5 protein	IDA	biological process
GO:0042567	insulin-like growth factor ternary complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043388	positive regulation of DNA binding	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045445	myoblast differentiation	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IDA	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045740	positive regulation of DNA replication	IDA	biological process
GO:0045821	positive regulation of glycolytic process	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0046326	positive regulation of glucose import	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048009	insulin-like growth factor receptor signaling pathway	IMP	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0051450	myoblast proliferation	IDA	biological process
GO:0060283	negative regulation of oocyte development	IMP	biological process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological process
GO:0070382	exocytic vesicle	ISS	cellular component
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:1904075	positive regulation of trophectodermal cell proliferation	IMP	biological process
GO:2000679	positive regulation of transcription regulatory region DNA binding	IDA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04068	FoxO signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04152	AMPK signaling pathway
hsa04150	mTOR signaling pathway
hsa04114	Oocyte meiosis
hsa04115	p53 signaling pathway
hsa04510	Focal adhesion
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04913	Ovarian steroidogenesis
hsa04914	Progesterone-mediated oocyte maturation
hsa04960	Aldosterone-regulated sodium reabsorption
hsa04730	Long-term depression
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05205	Proteoglycans in cancer
hsa05214	Glioma
hsa05218	Melanoma
hsa05215	Prostate cancer
hsa05224	Breast cancer
hsa05410	Hypertrophic cardiomyopathy
hsa05414	Dilated cardiomyopathy
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer	GAD: 16322331
Cancer (Adenocarcinoma)	GAD: 19064563
Cancer (Adenoma)	GAD: 20580999
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 18562769
Cancer (colon)	GAD: 18992263
Cancer (colorectal)	GAD: 15894673
Cancer (endometrial)	GAD: 21078522
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (esophageal)	GAD: 20453000
Cancer (fibromyoma)	GAD: 21460842
Cancer (Hepatocellular)	GAD: 20119675
Cancer (leiomyoma)	GAD: 18182398
Cancer (prostate)	GAD: 14693733
Cancer (testicular)	GAD: 19077426
Cancer (breast)	GAD: 16322331
Malignant mesothelioma	KEGG: H00015
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18636124
Cancer (melanoma)	GAD: 18237549
Cancer (myeloma)	GAD: 19124510
Cancer (ovarian)	GAD: 18236213
Apoplexy	GAD: 16361587
Atherosclerosis	GAD: 19948975
Cardiovascular disease	GAD: 16635594
Hypertension	GAD: 12791939
Intrauterine growth retardation	GAD: 19658040
Laron-type dwarfism	GAD: 2567724
Bronchopulmonary dysplasia	GAD: 18614962
Primary biliary cirrhosis	GAD: 15049048
Thyroid diseases	GAD: 19064126
Myopia	GAD: 20435602
Retinopathy	GAD: 18568888
Acromegaly	GAD: 20920870
Diabetes	GAD: 12732844
Hypercholesterolemia	GAD: 20602615
Insulin resistance	GAD: 19680783
Biliary cirrhosis	GAD: 15256976
Scoliosis	GAD: 19634821
Osteoarthritis	GAD: 15082485
Osteoporosis	GAD: 15049048
Bone diseases	GAD: 12915683
Subarachnoid hemorrhage	GAD: 15726267
Alzheimer's disease	GAD: 19141999
Autism	GAD: 19598235
Bulimia	GAD: 20468064
Chronic renal failure	GAD: 21085059
Abortion	GAD: 20587610
Chorioamnionitis	GAD: 20452482
Fetal Growth Retardation	GAD: 19217707
Preeclampsia	GAD: 17179726
Gonadal dysgenesis	INFBASE: 4039732
Diminished ovarian reserve (DOR)	INFBASE: 21846690
Endometriosis	INFBASE: 10785227
Oocyte maturation	INFBASE: 22532606
Chronic endometritis	INFBASE: 23351011
Female infertility	INFBASE: 12571183
Genital endometriosis	INFBASE: 16758620
Female infertility	INFBASE: 8654631
Polycystic ovary syndrome (PCOS)	INFBASE: 26802879
Premature ovarian failure (POF)	INFBASE: 9286728
Varicocele	MIK: 25343526
Germ cell development	MIK: 8981132
Male factor infertility	MIK: 8981132
Progressive motility	MIK: 8981132
Male factor infertility	MIK: 10100482
Gynecomastia	MIK: 26287961
Maturation arrest	MIK: 8981132
Hyperandrogenism	INFBASE: 9596926
Gynecomastia	INFBASE: 26287961
Hypogonadotropic hypogonadism	INFBASE: 17167799
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Breast diseases	GAD: 19551864
Connective tissue diseases	GAD: 19527514
Short stature	GAD: 14714750
Growth disorders	GAD: 17895313
Microalbuminuria	GAD: 16645019
Germ cell development	MIK: 8981132
Maturation of spermatozoa	MIK: 8981132
Progressive motility	MIK: 8981132
Gynecomastia	MIK: 26287961
Male infertility	MIK: 10100482
Varicocele	MIK: 25343526
Spermatogenic defects	MIK: 25726377
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26287961	Gynecomastia		Danish	106 (52 boys developed gynecomastia )	Male infertility	FSH LH SHBG inhibin B AMH
25343526	Male infertility, varicocele			99 (49 patients with varicocele and primary infertility before and after varicocelectomy, 50 healthy fertile men)	Male infertility
10100482	Male infertility			88 (44 fertile men, 34 male-factor infertile, 10 immunofertile)	Male infertility
8981132	Germ cell development, maturation of spermatozoa, progressive motility			80 (69 semen samples of various quality, 11 post-vasectomy samples)	Male infertility	IGF-I HGH alpha 2-M
10100482	Male infertility			88 (44 seminal plasma of fertile, 34 male-factor infertile, 10 immunoinfertile)	Male infertility	IGF-1
25726377	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R