• Gene id: 347735

Gene Summary

• Gene Symbol: SERINC2   Gene   UCSC   Ensembl
• Aliases: FKSG84, PRO0899, TDE2, TDE2L
• Gene name: serine incorporator 2
• Alternate names: serine incorporator 2, tumor differentially expressed protein 2,
• Gene location: 1p35.2 (31409776: 31434679)     Exons: 14     NC_000001.11

Protein Summary

• Protein general information: Q96SA4  
  • Name: Serine incorporator 2 (Tumor differentially expressed protein 2 like)
  • Length: 455  
  • Mass: 50742
• Sequence:

  MGACLGACSLLSCASCLCGSAPCILCSCCPASRNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPWVCEEG
  AGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYI
  PDGSFTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFM
  YYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPT
  QLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSLMQTEECPPMLDATQQQQQVAACEGR
  AFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMISTWTAVWVKICASWAGLLLYLWTLVAPLLLR
  NRDFS

• Structural information:
  • Interpro: IPR029554  IPR005016  
  • STRING: ENSP00000362814
• Other Databases: GeneCards:  SERINC2  Malacards:  SERINC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IBA	cellular component
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0006658	phosphatidylserine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1904219	positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity	IEA	biological process
GO:1904222	positive regulation of serine C-palmitoyltransferase activity	IEA	biological process
GO:0006658	phosphatidylserine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq