• Gene id: 347732

Gene Summary

• Gene Symbol: CATSPER3   Gene   UCSC   Ensembl
• Aliases: CACRC
• Gene name: cation channel sperm associated 3
• Alternate names: cation channel sperm-associated protein 3, ca(v)-like protein, calcium channel repeat containing 1, one-repeat calcium channel-like protein, putative ion channel CatSper3,
• Gene location: 5q31.1 (134967905: 135011706)     Exons: 8     NC_000005.10
• OMIM: 609120

Protein Summary

• Protein general information: Q86XQ3  
  • Name: Cation channel sperm associated protein 3 (CatSper3) (Ca(v) like protein) (One repeat calcium channel like protein)
  • Length: 398  
  • Mass: 46,422
• Sequence:

  MSQHRHQRHSRVISSSPVDTTSVGFCPTFKKFKRNDDECRAFVKRVIMSRFFKIIMISTVTSNAFFMALWTSYDI
  RYRLFRLLEFSEIFFVSICTSELSMKVYVDPINYWKNGYNLLDVIIIIVMFLPYALRQLMGKQFTYLYIADGMQS
  LRILKLIGYSQGIRTLITAVGQTVYTVASVLLLLFLLMYIFAILGFCLFGSPDNGDHDNWGNLAAAFFTLFSLAT
  VDGWTDLQKQLDNREFALSRAFTIIFILLASFIFLNMFVGVMIMHTEDSIRKFERELMLEQQEMLMGEKQVILQR
  QQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQDTTVHKLQELYYEIVH
  VLSLMLEDLPQEKPQSLEKVDEK

• Structural information:
  • Interpro: IPR005821  IPR027359  
  • STRING: ENSP00000282611
• Other Databases: GeneCards:  CATSPER3  Malacards:  CATSPER3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005245	voltage-gated calcium channel activity	IEA	molecular function
GO:0005261	cation channel activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0006816	calcium ion transport	IBA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0032570	response to progesterone	TAS	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0036128	CatSper complex	ISS	cellular component
GO:0048240	sperm capacitation	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0086010	membrane depolarization during action potential	IBA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005216	ion channel activity	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005245	voltage-gated calcium channel activity	IEA	molecular function
GO:0005261	cation channel activity	IBA	molecular function
GO:0005262	calcium channel activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006816	calcium ion transport	IBA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0032570	response to progesterone	TAS	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0036128	CatSper complex	IEA	cellular component
GO:0036128	CatSper complex	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0048240	sperm capacitation	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0086010	membrane depolarization during action potential	IBA	biological process
GO:0005261	cation channel activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006816	calcium ion transport	IBA	biological process
GO:0032570	response to progesterone	TAS	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0036128	CatSper complex	ISS	cellular component
GO:0086010	membrane depolarization during action potential	IBA	biological process

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 21255775
Asthenozoospermia	MIK: 21255775
Non obstructive azoospermia	MIK: 24012201
Required for hyperactivated sperm motility during capacitation and for male fertility	MIK: 17344468
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21255775	Asthenozoospermia	AKAP4 (c.887G>A -> p.Gly296Asn), CATSPER4 (c.247A>G -> p.Met83Val; c.157T>C -> p.Tyr53His; c.992G>A -> p.Gly331Asn), CATSPER1 (c.148G>A -> p.Val50Met), CATSPER3 (c.193T>C -> p.Phe65Leu), CATSPER2 (c.1289C>G -> p.Thr430Arg), PLA2G6 (c.187A>G -> p.Arg63Gly		30 men with isolated asthenozoospermia	Male infertility	ADCY10 AKAP4 CATSPER1 CATSPER2 CATSPER3 CATSPER4  GAPDHS PLA2G6 and SLC9A10
17344468	Required for hyperactivated sperm motility during capacitation and for male fertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)