• Gene id: 347730

Gene Summary

• Gene Symbol: LRRTM1   Gene   UCSC   Ensembl
• Gene name: leucine rich repeat transmembrane neuronal 1
• Alternate names: leucine-rich repeat transmembrane neuronal protein 1, leucine-rich repeat transmembrane neuronal 1 protein,
• Gene location: 2p12 (80304751: 80301877)     Exons: 2     NC_000002.12
• OMIM: 610867

Protein Summary

• Protein general information: Q86UE6  
  • Name: Leucine rich repeat transmembrane neuronal protein 1
  • Length: 522  
  • Mass: 58641
  • Tissue specificity: Predominantly expressed in forebrain regions including thalamus and cerebral cortex. {ECO
• Sequence:

  MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYN
  SLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLRSVDLSYNKLQ
  ALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVN
  FAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRIL
  NSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLL
  SAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAENAVQIHKVVTGTMALIFSFLIVVLVLYVSW
  KCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV

• Structural information:
  • Protein Domains: (35..6-)
    (/note="LRRNT-)
    (314..36-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000295057
• Other Databases: GeneCards:  LRRTM1  Malacards:  LRRTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0050808	synapse organization	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0002091	negative regulation of receptor internalization	IEA	biological process
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0060076	excitatory synapse	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0035640	exploration behavior	IEA	biological process
GO:0035418	protein localization to synapse	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IDA	cellular component
GO:0009986	cell surface	IDA	NOT|cellular component
GO:0030424	axon	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IMP	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)