• Gene id: 3476

Gene Summary

• Gene Symbol: IGBP1   Gene   UCSC   Ensembl
• Aliases: ALPHA-4, IBP1, alpha4
• Gene name: immunoglobulin binding protein 1
• Alternate names: immunoglobulin-binding protein 1, B cell signal transduction molecule alpha 4, CD79a-binding protein 1, bA351K23.1 (immunoglobulin binding protein 1 (CD79A) ), immunoglobulin (CD79A) binding protein 1, protein alpha-4, protein phosphatase 2/4/6 regulatory subun,
• Gene location: Xq13.1 (70133446: 70166323)     Exons: 7     NC_000023.11
• Gene summary(Entrez): The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signa
• OMIM: 300139

Protein Summary

• Protein general information: P78318  
  • Name: Immunoglobulin binding protein 1 (B cell signal transduction molecule alpha 4) (Protein alpha 4) (CD79a binding protein 1) (Protein phosphatase 2/4/6 regulatory subunit) (Renal carcinoma antigen NY REN 16)
  • Length: 339  
  • Mass: 39222
  • Tissue specificity: Ubiquitously expressed with highest levels in heart, skeletal muscle and pancreas.
• Sequence:

  MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEIASTD
  LKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVA
  MASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSR
  EASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ
  EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG

• Structural information:
  • Protein Domains: (46..6-)
    (/note="UIM-)
    (/evidence="ECO:0000305"-)
  • Interpro: IPR038511  IPR007304  
  • PDB: 4IYP
  • PDBsum: 4IYP
  • STRING: ENSP00000363661
• Other Databases: GeneCards:  IGBP1  Malacards:  IGBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0035303	regulation of dephosphorylation	IBA	biological process
GO:0051721	protein phosphatase 2A binding	IBA	molecular function
GO:0070555	response to interleukin-1	IMP	biological process
GO:0034612	response to tumor necrosis factor	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042113	B cell activation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0019888	protein phosphatase regulator activity	IDA	molecular function
GO:0060632	regulation of microtubule-based movement	IMP	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005737	cytoplasm	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Corpus callosum, agenesis of, with mental retardation, ocular coloboma and micrognathia	KEGG:H01035
Corpus callosum, agenesis of, with mental retardation, ocular coloboma and micrognathia	KEGG:H01035
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)