• Gene id: 347527

Gene Summary

• Gene Symbol: ARSH   Gene   UCSC   Ensembl
• Aliases: sulfatase
• Gene name: arylsulfatase family member H
• Alternate names: arylsulfatase H, ASH,
• Gene location: Xp22.33 (153536048: 153534598)     Exons: 3     NC_000001.11
• Gene summary(Entrez): Sulfatases, such as ARSH, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [P
• OMIM: 300586

Protein Summary

• Protein general information: Q5FYA8  
  • Name: Arylsulfatase H (ASH) (EC 3.1.6. )
  • Length: 562  
  • Mass: 63525
• Sequence:

  MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRAAFLTGRYPIRSGMVS
  AYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGLSCASRNDHCYHPLNHGFHYFYGVPFGLLSD
  CQASKTPELHRWLRIKLWISTVALALVPFLLLIPKFARWFSVPWKVIFVFALLAFLFFTSWYSSYGFTRRWNCIL
  MRNHEIIQQPMKEEKVASLMLKEALAFIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMV
  GKILDALDQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGMGGWEGGIRVPGIFRWPSVLEAGRVI
  NEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDHEFLFHYCGVYLHTVRWHQKDCATVWKAHYV
  TPKFYPEGTGACYGSGICSCSGDVTYHDPPLLFDISRDPSEALPLNPDNEPLFDSVIKKMEAAIREHRRTLTPVP
  QQFSVFNTIWKPWLQPCCGTFPFCGCDKEDDILPMAP

• Structural information:
  • Interpro: IPR017850  IPR024607  IPR000917  
  • Prosite: PS00523 PS00149
  • STRING: ENSP00000370522
• Other Databases: GeneCards:  ARSH  Malacards:  ARSH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004065	arylsulfatase activity	TAS	molecular function
GO:0004065	arylsulfatase activity	IBA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)