• Gene id: 347148

Gene Summary

• Gene Symbol: QRFP   Gene   UCSC   Ensembl
• Aliases: 26RFa, P518
• Gene name: pyroglutamylated RFamide peptide
• Alternate names: orexigenic neuropeptide QRFP, P518 precursor protein, RF(Arg-Phe)amide family 26 amino acid peptide (P518), prepro-QRFP,
• Gene location: 9q34.12 (50026004: 50048775)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine
• OMIM: 609795

Protein Summary

• Protein general information: P83859  
  • Name: Orexigenic neuropeptide QRFP (P518) [Cleaved into: QRF amide (Neuropeptide RF amide) (Pyroglutamylated arginine phenylalanine amide peptide)]
  • Length: 136  
  • Mass: 14941
  • Tissue specificity: Expressed widely in the brain with highest expression levels in the cerebellum, medulla, pituitary, retina, vestibular nucleus, and white matter. Also expressed in the bladder, colon, coronary artery, parathyroid gland, prostate, testi
• Sequence:

  MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQ
  TSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR

• Structural information:
  • Interpro: IPR024565  
  • STRING: ENSP00000485512
• Other Databases: GeneCards:  QRFP  Malacards:  QRFP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0031854	orexigenic neuropeptide QRFP receptor binding	IBA	molecular function
GO:0031854	orexigenic neuropeptide QRFP receptor binding	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0031854	orexigenic neuropeptide QRFP receptor binding	IEA	molecular function
GO:0007625	grooming behavior	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005184	neuropeptide hormone activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0031854	orexigenic neuropeptide QRFP receptor binding	ISS	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0060259	regulation of feeding behavior	ISS	biological process
GO:0045777	positive regulation of blood pressure	ISS	biological process
GO:0007626	locomotory behavior	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881