• Gene id: 347

Gene Summary

• Gene Symbol: APOD   Gene   UCSC   Ensembl
• Gene name: apolipoprotein D
• Alternate names: apolipoprotein D, apo-D,
• Gene location: 3q29 (195583939: 195568704)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamil
• OMIM: 107740

Protein Summary

• Protein general information: P05090  
  • Name: Apolipoprotein D (Apo D) (ApoD)
  • Length: 189  
  • Mass: 21276
  • Tissue specificity: Expressed in liver, intestine, pancreas, kidney, placenta, adrenal, spleen, fetal brain tissue and tears.
• Sequence:

  MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIK
  VLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILA
  RNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

• Structural information:
  • Interpro: IPR026222  IPR002969  IPR012674  IPR022271  IPR022272   IPR000566  
  • Prosite: PS00213
  • PDB: 2APD 2HZQ 2HZR
  • PDBsum: 2APD 2HZQ 2HZR
  • STRING: ENSP00000345179
• Other Databases: GeneCards:  APOD  Malacards:  APOD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0006629	lipid metabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0006869	lipid transport	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:0060588	negative regulation of lipoprotein lipid oxidation	IEA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0006006	glucose metabolic process	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0000302	response to reactive oxygen species	IDA	biological process
GO:0060588	negative regulation of lipoprotein lipid oxidation	IDA	biological process
GO:0042308	negative regulation of protein import into nucleus	IDA	biological process
GO:2000405	negative regulation of T cell migration	IDA	biological process
GO:1900016	negative regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0015485	cholesterol binding	IDA	molecular function
GO:0006629	lipid metabolic process	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005319	lipid transporter activity	NAS	molecular function
GO:0043025	neuronal cell body	ISS	cellular component
GO:0042246	tissue regeneration	ISS	biological process
GO:0007420	brain development	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:2000098	negative regulation of smooth muscle cell-matrix adhesion	IMP	biological process
GO:0051895	negative regulation of focal adhesion assembly	IMP	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0022626	cytosolic ribosome	ISS	cellular component
GO:0007568	aging	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0001525	angiogenesis	NAS	biological process
GO:0042493	response to drug	ISS	biological process
GO:0014012	peripheral nervous system axon regeneration	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9751198
Gestational diabetes	PMID:6828336
type 2 diabetes mellitus	PMID:15369805
type 2 diabetes mellitus	PMID:7895459
obesity	PMID:7913935
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)