• Gene id: 3467

Gene Summary

• Gene Symbol: IFNW1   Gene   UCSC   Ensembl
• Gene name: interferon omega 1
• Alternate names: interferon omega-1, IFN-omega 1, interferon omega-1, interferon alpha-II-1,
• Gene location: 9p21.3 (21141900: 21140631)     Exons: 1     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout th

Protein Summary

• Protein general information: P05000  
  • Name: Interferon omega 1 (Interferon alpha II 1)
  • Length: 195  
  • Mass: 22319
• Sequence:

  MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAH
  VMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGI
  RVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS

• Structural information:
  • Interpro: IPR009079  IPR000471  
  • Prosite: PS00252
  • CDD: cd00095
  • PDB: 3SE4
  • PDBsum: 3SE4
  • STRING: ENSP00000369578
• Other Databases: GeneCards:  IFNW1  Malacards:  IFNW1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002286	T cell activation involved in immune response	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006959	humoral immune response	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030183	B cell differentiation	IBA	biological process
GO:0043330	response to exogenous dsRNA	IBA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0002323	natural killer cell activation involved in immune response	IBA	biological process
GO:0005132	type I interferon receptor binding	IBA	molecular function
GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	biological process
GO:0042100	B cell proliferation	IBA	biological process
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005126	cytokine receptor binding	TAS	molecular function
GO:0007050	cell cycle arrest	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq