Male Infertility Database

Search Result

Gene id

3458

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

IFNG Gene UCSC Ensembl

Aliases

IFG, IFI

Gene name

interferon gamma

Alternate names

interferon gamma, IFN-gamma, immune interferon,

Gene location

12q15 (68159740: 68154769) Exons: 4 NC_000012.12

Gene summary(Entrez)

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor w

OMIM

147570

SNPs

rs118204043

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.116628175C>T
NC_000006.11   g.116949338C>T
NG_012934.1   g.16697C>T
NM_001010892.2   c.1468C>T
NM_001010892.3   c.1468C>T
NM_001161664.1   c.1468C>T
XM_017010826.1   c.1468C>T
NP_001010892.1   p.Arg490Ter
NP_001155136.1   p.Arg490Ter
XP_016866315.1   p.

rs118204042

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.116616948C>T
NC_000006.11   g.116938111C>T
NG_012934.1   g.5470C>T
NM_001010892.2   c.325C>T
NM_001010892.3   c.325C>T
NM_001161664.1   c.325C>T
XM_017010826.1   c.325C>T
NP_001010892.1   p.Gln109Ter
NP_001155136.1   p.Gln109Ter
XP_016866315.1   p.Gln10

rs118204041

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.116617083C>T
NC_000006.11   g.116938246C>T
NG_012934.1   g.5605C>T
NM_001010892.2   c.460C>T
NM_001010892.3   c.460C>T
NM_001161664.1   c.460C>T
XM_017010826.1   c.460C>T
NP_001010892.1   p.Gln154Ter
NP_001155136.1   p.Gln154Ter
XP_016866315.1   p.Gln15

rs3779456

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.27174938T>C
NC_000007.13   g.27214557T>C|SEQ=[T/C]|GENE=HOXA10
HOXA10-HOXA9   100534589

rs2430561

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.68158742T>A
NC_000012.11   g.68552522T>A
NG_015840.1   g.6000A>T|SEQ=[T/A]|GENE=IFNG

Protein Summary

Protein general information

P01579

Name: Interferon gamma (IFN gamma) (Immune interferon)

Length: 166 Mass: 19,348

Tissue specificity: Testis specific.

Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSF
YFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTG
KRKRSQMLFRGRRASQ

Structural information

Interpro:	IPR009079 IPR002069
PDB:	1EKU 1FG9 1FYH 1HIG 3BES
PDBsum:	1EKU 1FG9 1FYH 1HIG 3BES
DIP:	483
STRING:	ENSP00000229135

Other Databases

GeneCards: IFNG Malacards: IFNG

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IDA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0001781	neutrophil apoptotic proc ess	IEA	biological process
GO:0002026	regulation of the force o f heart contraction	IEA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0002302	CD8-positive, alpha-beta T cell differentiation in volved in immune response	IEA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005133	interferon-gamma receptor binding	IEA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006915	apoptotic process	IGI	biological process
GO:0006928	movement of cell or subce llular component	TAS	biological process
GO:0006959	humoral immune response	IBA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009897	external side of plasma m embrane	IEA	cellular component
GO:0010508	positive regulation of au tophagy	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010629	negative regulation of ge ne expression	IDA	biological process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological process
GO:0019882	antigen processing and pr esentation	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological process
GO:0031642	negative regulation of my elination	IEA	biological process
GO:0032224	positive regulation of sy naptic transmission, chol inergic	IEA	biological process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042742	defense response to bacte rium	IEA	biological process
GO:0042832	defense response to proto zoan	IEA	biological process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological process
GO:0050796	regulation of insulin sec retion	IDA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0050954	sensory perception of mec hanical stimulus	IEA	biological process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological process
GO:0071351	cellular response to inte rleukin-18	IEA	biological process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological process
GO:0098908	regulation of neuronal ac tion potential	IEA	biological process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological process
GO:0000060	protein import into nucle us, translocation	IDA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0001781	neutrophil apoptotic proc ess	IEA	biological process
GO:0002026	regulation of the force o f heart contraction	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0002302	CD8-positive, alpha-beta T cell differentiation in volved in immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005133	interferon-gamma receptor binding	IEA	molecular function
GO:0005133	interferon-gamma receptor binding	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005622	intracellular	IEA	cellular component
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	IGI	biological process
GO:0006925	inflammatory cell apoptot ic process	IEA	biological process
GO:0006928	movement of cell or subce llular component	TAS	biological process
GO:0006955	immune response	IEA	biological process
GO:0006959	humoral immune response	IEA	biological process
GO:0006959	humoral immune response	IBA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0009897	external side of plasma m embrane	IEA	cellular component
GO:0010508	positive regulation of au tophagy	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010629	negative regulation of ge ne expression	IDA	biological process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological process
GO:0019882	antigen processing and pr esentation	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological process
GO:0031642	negative regulation of my elination	IEA	biological process
GO:0032224	positive regulation of sy naptic transmission, chol inergic	IEA	biological process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IEA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IEA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042742	defense response to bacte rium	IEA	biological process
GO:0042832	defense response to proto zoan	IEA	biological process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological process
GO:0044146	negative regulation of gr owth of symbiont involved in interaction with host	IEA	biological process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological process
GO:0050776	regulation of immune resp onse	IEA	biological process
GO:0050796	regulation of insulin sec retion	IDA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0050954	sensory perception of mec hanical stimulus	IEA	biological process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological process
GO:0071351	cellular response to inte rleukin-18	IEA	biological process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological process
GO:0098908	regulation of neuronal ac tion potential	IEA	biological process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological process
GO:0000060	protein import into nucle us, translocation	IDA	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005133	interferon-gamma receptor binding	TAS	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0006915	apoptotic process	IGI	biological process
GO:0006928	movement of cell or subce llular component	TAS	biological process
GO:0006959	humoral immune response	IBA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological process
GO:0009615	response to virus	IDA	biological process
GO:0010508	positive regulation of au tophagy	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010628	positive regulation of ge ne expression	IDA	biological process
GO:0010629	negative regulation of ge ne expression	IDA	biological process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological process
GO:0050796	regulation of insulin sec retion	IDA	biological process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04217	Necroptosis
hsa04650	Natural killer cell mediated cytotoxicity
hsa04612	Antigen processing and presentation
hsa04660	T cell receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04657	IL-17 signaling pathway
hsa04380	Osteoclast differentiation
hsa05200	Pathways in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05322	Systemic lupus erythematosus
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05330	Allograft rejection
hsa05332	Graft-versus-host disease
hsa05418	Fluid shear stress and atherosclerosis
hsa04940	Type I diabetes mellitus
hsa05132	Salmonella infection
hsa05152	Tuberculosis
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05146	Amoebiasis
hsa05144	Malaria
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease
hsa05143	African trypanosomiasis

Diseases

Expand All | Collapse All

Associated diseases	References
Angiomyolipoma	GAD: 12192641
Cancer	GAD: 19959217
Cancer (Adenocarcinoma)	GAD: 19152246
Cancer (bladder)	GAD: 16938461
Cancer (breast)	GAD: 15931634
Cancer (cervical)	GAD: 15499631
Cancer (colorectal)	GAD: 17454884
Cancer (esophageal)	GAD: 19801321
Cancer (ovarian)	INFBASE: 17707463
Cancer (Hepatocellular)	GAD: 19126646
Cancer (kidney)	GAD: 15784411
Cancer (leukemia)	GAD: 15932621
Cancer (liver)	GAD: 15643599
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 18633131
Cancer (melanoma)	GAD: 15709194
Cancer (nasopharyngeal)	GAD: 18312596
Cancer (pancreatic)	GAD: 15556691
Cancer (Squamous cell)	GAD: 19495883
Cancer (stomach)	GAD: 17444864
Kidney angiomyolipomas	GAD: 12192641
Angina pectoris	GAD: 19005292
Atherosclerosis	GAD: 16115485
Cardiovascular disease	GAD: 15570643
Carotid artery diseases	GAD: 15992611
Omenn syndrome severe combined immunideficiency	GAD: 17572155
Irritable bowel syndrome	GAD: 20177758
Liver disease	GAD: 15078471
Hashimoto disease	GAD: 19250279
Hashimoto disease	GAD: 16820703
Graves disease	GAD: 15068623
Uveitis	GAD: 16024856
Chorioretinitis	GAD: 19547871
Anemia	GAD: 18426658
Sarcoidosis	GAD: 15019280
Aplastic anemia	KEGG: H01132
Langerhans cell histiocytosis	GAD: 16487180
Hodgkin disease	GAD: 19508433
Lymphoproliferative disorders	GAD: 16824159
Idiopathic thrombocytopenic purpura	GAD: 17655693
Allergy	GAD: 11354638
Arthritis	GAD: 11981324
Asthma	GAD: 11240951
Bronchial hyperreactivity	GAD: 19247692
Asthma	GAD: 11240951
Atopy	GAD: 15007355
Autoimmune diseases	GAD: 20082482
Behcet's disease	GAD: 19796538
Bullous pemphigoid	GAD: 16403098
Celiac disease	GAD: 15215891
Sjogren's syndrome	GAD: 16166103
Juvenile arthritis	GAD: 15901906
Ulcerative colitis	GAD: 19122664
Rheumatoid arthritis	GAD: 15018649
Multiple sclerosis	GAD: 16183136
Scleroderma	GAD: 18576303
Psoriasis	GAD: 11298547
Systemic lupus erythematosus (SLE)	GAD: 20530519
Systemic lupus erythematosus (SLE)	GAD: 11528517
Celiac disease	GAD: 15215891
Inflammatory bowel disease	GAD: 15842590
Diabetes	GAD: 12818128
Degenerative arthropathy	GAD: 17994425
Osteolysis	GAD: 19860911
Idiopathic inflammatory myopathies	GAD: 17405833
Giant cell arteritis	GAD: 15570643
Uveomeningoencephalitic syndrome	GAD: 18199975
Myasthenia gravis	GAD: 17509455
Alzheimer's disease	GAD: 16930778
Parkinson disease	GAD: 18568448
Chronic fatigue syndrome	GAD: 16762155
Mood disorders	GAD: 19890236
Chronic renal failure	GAD: 20303284
Kidney diseases	GAD: 18627514
Abortion	GAD: 20587610
Preeclampsia	GAD: 16433832
Preterm birth risk	GAD: 19375805
Preterm birth risk	GAD: 17145371
Adenomyosis	INFBASE: 12069392
Deep infiltrating endometriosis	INFBASE: 11327093
Endometrial polyp	INFBASE: 21872231
Endometriosis	INFBASE: 22007253
Female infertility	INFBASE: 17706208
Leiomyoma	INFBASE: 14597251
Recurrent implantation�failure�(RIF)	INFBASE: 12615834
Reproductive disorderes	INFBASE: 12607776
Endometriosis	INFBASE: 17959888
Polycystic ovary syndrome (PCOS)	INFBASE: 26751822
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Recurrent pregnancy loss (RPL)	INFBASE: 26368793
Recurrent pregnancy loss (RPL)	INFBASE: 17482605
Recurrent pregnancy loss (RPL)	INFBASE: 12660269
Unexplained infertility	INFBASE: 24368037
Male factor infertility	MIK: 11476770
Obstructive azoospermia	MIK: 19811461
Male subfertility	MIK: 19811461
Sperm motility	MIK: 1601744
Male subfertility	MIK: 19811461
Implantation�failure	INFBASE: 15105393
Infertility	INFBASE: 26114934
Female infertility	INFBASE: 7500318
Asthenozoospermia	MIK: 19811461
Interstitial lung diseases	GAD: 19117745
Lung disease	GAD: 16474934
Pulmonary fibrosis	GAD: 12914676
Severe acute respiratory syndrome	GAD: 19258635
Chronic obstructive pulmonary disease (COPD)	GAD: 18410260
Wegener granulomatosis	GAD: 15708894
Asthma	GAD: 11240951
Dermatitis	GAD: 16681592
Vitiligo	GAD: 18820938
Pemphigus vulgaris	GAD: 19470040
Connective tissue diseases	GAD: 19527514
Gingival hemorrhage	GAD: 18672993
Bronchiectasis	GAD: 17026468
Bronchiolitis	GAD: 19773677
Bronchiolitis	GAD: 12451269
TSC2 angiomyolipomas	OMIM: 147570
Nephropathy	GAD: 12552499
Male infertility	MIK: 26648778
Obstructed azoospermia	MIK: 19811461
Asthenozoospermia	MIK: 19811461
Sperm motility	MIK: 1601744

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
19811461	Male subfe rtility	77 male partner s of an inferti le couple	Male infertility	IL-6 IL-8 IL-10 IL-11 IL-12 �TNF-alpha and IFN-gamma	Show abstract
7928663	Male infer tility	27 (15 infertil e men, 10 ferti le men)	Male infertility	TNF-alpha IFN-gamma IL-1 beta IL-8	Show abstract
26648778	Male infer tility	82 (27 healthy controls, 55 in fertile patient s (22 patients with varicocele , 13 with idiop athic infertili ty) )	Male infertility	IL-1? IL-10 IL-18 TGF-?1 IFN-g IL-6	Show abstract
19811461	Subfertile men	79 male partner s	Male infertility	IL-6 IL-10 TNF-alpha IFN-gamma	Show abstract
11476770	Male facto r infertil ity	9 sperm donors	Male infertility	TYK 2 STAT 1 IFN-alpha IFN-gamma IL-12 TYK 2 STAT 4	Show abstract
10813851	Male�infer tility		Male�infertility		Show abstract
1601744	Sperm moti lity, Male infertili ty		Male infertility		Show abstract
19811461	Obstructed azoosperm ia, asthen ospermia	73 male partner s of an inferti le couple atten ding a regional andrology unit �	Male infertility	�IL-6 IL-8 IL-10 IL-11 IL-12 TNF-alpha and IFN-gamma	Show abstract
11380702	Male facto r infertil ity		Male infertility		Show abstract
16674600	Male infer tility, ge nital trac t infectio ns	80 (18 fertile men, 17 inferti le men with gen ital tract infe ctions, 15 infe rtile men with varicocele, 6 w ith Klienfelter syndrome, 7 wi th cryptorchidi sm, 7 with mump s orchitis, 10 with idiopathic testicular les ions)	Male infertility	IL-18 IFN-gamma�	Show abstract
8738079	Male infer tility	41 (20 had prov en fertility an d normal semen quality (fertil e group), 21 sh owed male infer tility for at l east 2 years an d poor semen qu ality (infertil e group))	Male infertility	INF-gamma	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

SNPs

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All