• Gene id: 345611

Gene Summary

• Gene Symbol: IRGM   Gene   UCSC   Ensembl
• Aliases: IFI1, IRGM1, LRG-47, LRG47
• Gene name: immunity related GTPase M
• Alternate names: immunity-related GTPase family M protein, LPS-stimulated RAW 264.7 macrophage protein 47 homolog, LRG-47-like protein, immunity-related GTPase family, M1, interferon-inducible protein 1,
• Gene location: 5q33.1 (150846520: 150902401)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the p47 immunity-related GTPase family. The encoded protein may play a role in the innate immune response by regulating autophagy formation in response to intracellular pathogens. Polymorphisms that affect the normal expressi
• OMIM: 608212

Protein Summary

• Protein general information: A1A4Y4  
  • Name: Immunity related GTPase family M protein (EC 3.6.5. ) (Immunity related GTPase family M protein 1) (Interferon inducible protein 1) (LPS stimulated RAW 264.7 macrophage protein 47 homolog) (LRG 47)
  • Length: 181  
  • Mass: 20142
  • Tissue specificity: Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes. {ECO
• Sequence:

  MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRC
  ASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDM
  DLSTGALPEVQLLQIRENVLENLQKERVCEY

• Structural information:
  • Protein Domains: (32..18-)
    (/note="IRG-type-G")
  • Interpro: IPR030385  IPR007743  IPR027417  
  • Prosite: PS51716
  • STRING: ENSP00000428220
• Other Databases: GeneCards:  IRGM  Malacards:  IRGM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035458	cellular response to interferon-beta	IBA	biological process
GO:0006952	defense response	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0001891	phagocytic cup	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0042742	defense response to bacterium	IMP	biological process
GO:0075044	positive regulation by symbiont of host autophagy	IMP	biological process
GO:1901098	positive regulation of autophagosome maturation	IMP	biological process
GO:0050829	defense response to Gram-negative bacterium	IMP	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051434	BH3 domain binding	IMP	molecular function
GO:0070431	nucleotide-binding oligomerization domain containing 2 signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050700	CARD domain binding	IMP	molecular function
GO:0031648	protein destabilization	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0061635	regulation of protein complex stability	IMP	biological process
GO:0061762	CAMKK-AMPK signaling cascade	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process
GO:0000045	autophagosome assembly	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061739	protein lipidation involved in autophagosome assembly	IMP	biological process
GO:0075044	positive regulation by symbiont of host autophagy	IMP	biological process
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular function
GO:0060335	positive regulation of interferon-gamma-mediated signaling pathway	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0043254	regulation of protein-containing complex assembly	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05145	Toxoplasmosis

Diseases

Associated diseases	References
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Crohn disease	KEGG:H00286
Inflammatory bowel disease	KEGG:H01227
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)