• Gene id: 344901

Gene Summary

• Gene Symbol: OSTN   Gene   UCSC   Ensembl
• Aliases: MUSCLIN
• Gene name: osteocrin
• Alternate names: osteocrin,
• Gene location: 3q28 (191199240: 191265614)     Exons: 6     NC_000003.12
• OMIM: 162660

Protein Summary

• Protein general information: P61366  
  • Name: Osteocrin (Musclin) [Cleaved into: Processed Osteocrin]
  • Length: 133  
  • Mass: 14722
  • Tissue specificity: Enriched in neocortical regions of the developing cerebral cortex (PubMed
• Sequence:

  MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDV
  IETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

• Structural information:
  • Interpro: IPR021088  
  • STRING: ENSP00000342356
• Other Databases: GeneCards:  OSTN  Malacards:  OSTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903860	negative regulation of dendrite extension	IMP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0009755	hormone-mediated signaling pathway	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0003416	endochondral bone growth	IEA	biological process
GO:0046325	negative regulation of glucose import	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881