• Gene id: 344838

Gene Summary

• Gene Symbol: PAQR9   Gene   UCSC   Ensembl
• Gene name: progestin and adipoQ receptor family member 9
• Alternate names: membrane progestin receptor epsilon, mPR epsilon, membrane progesterone P4 receptor epsilon, membrane progesterone receptor epsilon, progesterone and adipoQ receptor family member 9, progestin and adipoQ receptor family member IX,
• Gene location: 3q23 (142964007: 142949163)     Exons: 5     NC_000003.12
• OMIM: 614580

Protein Summary

• Protein general information: Q6ZVX9  
  • Name: Membrane progestin receptor epsilon (mPR epsilon) (Membrane progesterone P4 receptor epsilon) (Membrane progesterone receptor epsilon) (Progesterone and adipoQ receptor family member 9) (Progestin and adipoQ receptor family member 9) (Progestin and adipoQ
  • Length: 377  
  • Mass: 42692
  • Tissue specificity: Expression levels vary widely in a range of tissues (PubMed
• Sequence:

  MPRRLQPRGAGTKGPPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECLA
  SVLKPTNETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMSCTAHVFSCLSLRLR
  AAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARVMTPYLQQRLGWHVDCTRLIAAYRALVLPVAFVLAVACT
  VACCKSRTDWCTYPFALRTFVFVMPLSMACPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQ
  PGLFDIIGHSHQLFHIFTFLSIYDQVYYVEEGLRQFLQAPPAAPTFSGTVGYMLLLVVCLGLVIRKFLNSSEFCS
  KK

• Structural information:
  • Interpro: IPR004254  
  • STRING: ENSP00000341564
• Other Databases: GeneCards:  PAQR9  Malacards:  PAQR9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005496	steroid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq