• Gene id: 3445

Gene Summary

• Gene Symbol: IFNA8   Gene   UCSC   Ensembl
• Aliases: IFN-alphaB
• Gene name: interferon alpha 8
• Alternate names: interferon alpha-8, IFN-alpha-8, interferon alpha type 201, interferon alpha-B, interferon alpha-B', interferon alpha-B2, leIF B,
• Gene location: 9p21.3 (21409116: 21410184)     Exons: 1     NC_000009.12
• OMIM: 147568

Protein Summary

• Protein general information: P32881  
  • Name: Interferon alpha 8 (IFN alpha 8) (Interferon alpha B) (LeIF B) (Interferon alpha B2)
  • Length: 189  
  • Mass: 21989
• Sequence:

  MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQ
  AISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAVRKYFQRI
  TLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE

• Structural information:
  • Interpro: IPR009079  IPR000471  
  • Prosite: PS00252
  • CDD: cd00095
  • DIP: 6017
  • STRING: ENSP00000369553
• Other Databases: GeneCards:  IFNA8  Malacards:  IFNA8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002286	T cell activation involved in immune response	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006959	humoral immune response	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0030183	B cell differentiation	IBA	biological process
GO:0043330	response to exogenous dsRNA	IBA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0002323	natural killer cell activation involved in immune response	IBA	biological process
GO:0005132	type I interferon receptor binding	IBA	molecular function
GO:0033141	positive regulation of peptidyl-serine phosphorylation of STAT protein	IBA	biological process
GO:0042100	B cell proliferation	IBA	biological process
GO:0005126	cytokine receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0005126	cytokine receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05152	Tuberculosis
hsa04217	Necroptosis
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05162	Measles
hsa04650	Natural killer cell mediated cytotoxicity
hsa04620	Toll-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway
hsa05320	Autoimmune thyroid disease

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)