• Gene id: 344387

Gene Summary

• Gene Symbol: CDKL4   Gene   UCSC   Ensembl
• Gene name: cyclin dependent kinase like 4
• Alternate names: cyclin-dependent kinase-like 4,
• Gene location: 2p22.1 (39248834: 39168044)     Exons: 18     NC_000002.12

Protein Summary

• Protein general information: Q5MAI5  
  • Name: Cyclin dependent kinase like 4 (EC 2.7.11.22)
  • Length: 379  
  • Mass: 43384
• Sequence:

  MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRK
  MHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQI
  LIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQ
  SIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRKARN
  EGRNRRRQQQAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNSMVTVMTNINSAVYQVTVLHLLSENF
  EVKS

• Structural information:
  • Protein Domains: (4..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • STRING: ENSP00000368080
• Other Databases: GeneCards:  CDKL4  Malacards:  CDKL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)