• Gene id: 3437

Gene Summary

• Gene Symbol: IFIT3   Gene   UCSC   Ensembl
• Aliases: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, P60, RIG-G, cig41
• Gene name: interferon induced protein with tetratricopeptide repeats 3
• Alternate names: interferon-induced protein with tetratricopeptide repeats 3, CIG49, IFI-60K, IFIT-3, IFIT-4, ISG-60, interferon-induced 60 kDa protein, interferon-induced protein with tetratricopeptide repeats 4, retinoic acid-induced gene G protein,
• Gene location: 10q23.31 (89327996: 89340967)     Exons: 4     NC_000010.11
• OMIM: 607038

Protein Summary

• Protein general information: O14879  
  • Name: Interferon induced protein with tetratricopeptide repeats 3 (IFIT 3) (CIG49) (ISG 60) (Interferon induced 60 kDa protein) (IFI 60K) (Interferon induced protein with tetratricopeptide repeats 4) (IFIT 4) (Retinoic acid induced gene G protein) (P60) (RIG G)
  • Length: 490  
  • Mass: 55985
  • Tissue specificity: Expression significantly higher in peripheral blood mononuclear cells (PBMCs) and monocytes from systemic lupus erythematosus (SLE) patients than in those from healthy individuals (at protein level). Spleen, lung, leukocytes, lymph nod
• Sequence:

  MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLR
  QAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCG
  RNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAE
  GEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQIGCCYKAKVRQMQNTGESEA
  SGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNKEVPDAEKQQSHQRYCNLQKYNGKSE
  DTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYLQGLIHKQNGDLLQAAKCYEKELGRLLRDAP
  SGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN

• Structural information:
  • Interpro: IPR024122  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 6C6K
  • PDBsum: 6C6K
  • DIP: 37890
  • STRING: ENSP00000360883
• Other Databases: GeneCards:  IFIT3  Malacards:  IFIT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0009615	response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035457	cellular response to interferon-alpha	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray