• Gene id: 3434

Gene Summary

• Gene Symbol: IFIT1   Gene   UCSC   Ensembl
• Aliases: C56, G10P1, IFI-56, IFI-56K, IFI56, IFIT-1, IFNAI1, ISG56, P56, RNM561
• Gene name: interferon induced protein with tetratricopeptide repeats 1
• Alternate names: interferon-induced protein with tetratricopeptide repeats 1, interferon, alpha-inducible protein (MW 56kD), interferon-induced 56 kDa protein, interferon-inducible mRNA 561,
• Gene location: 10q23.31 (89392545: 89406486)     Exons: 4     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein containing tetratricopeptide repeats that was originally identified as induced upon treatment with interferon. The encoded protein may inhibit viral replication and translational initiation. This gene is located in a cluster on
• OMIM: 147690

Protein Summary

• Protein general information: P09914  
  • Name: Interferon induced protein with tetratricopeptide repeats 1 (IFIT 1) (Interferon induced 56 kDa protein) (IFI 56K) (P56)
  • Length: 478  
  • Mass: 55360
• Sequence:

  MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSL
  KEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALL
  KCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLAL
  KLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
  QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEE
  TMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLE
  GNMNEALEYYERALRLAADFENSVRQGP

• Structural information:
  • Interpro: IPR024121  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 4HOU 5UDI 5UDJ 5UDK 5UDL 5W5H 5W5I 6C6K
  • PDBsum: 4HOU 5UDI 5UDJ 5UDK 5UDL 5W5H 5W5I 6C6K
  • DIP: 37898
  • STRING: ENSP00000360869
• Other Databases: GeneCards:  IFIT1  Malacards:  IFIT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0051607	defense response to virus	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0009615	response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009615	response to virus	IEA	biological process
GO:0071357	cellular response to type I interferon	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0050688	regulation of defense response to virus	IEA	biological process
GO:0071360	cellular response to exogenous dsRNA	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009615	response to virus	IDA	biological process
GO:0019060	intracellular transport of viral protein in host cell	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IDA	biological process
GO:0071357	cellular response to type I interferon	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0051097	negative regulation of helicase activity	IDA	biological process
GO:0071360	cellular response to exogenous dsRNA	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043657	host cell	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R