• Gene id: 3433

Gene Summary

• Gene Symbol: IFIT2   Gene   UCSC   Ensembl
• Aliases: G10P2, GARG-39, IFI-54, IFI-54K, IFI54, IFIT-2, ISG-54 K, ISG-54K, ISG54, P54, cig42
• Gene name: interferon induced protein with tetratricopeptide repeats 2
• Alternate names: interferon-induced protein with tetratricopeptide repeats 2, Interferon, alpha-inducible protein (MW 54kD), interferon-induced 54 kDa protein, interferon-induced protein 54,
• Gene location: 10q23.31 (89302045: 89309270)     Exons: 2     NC_000010.11
• OMIM: 147040

Protein Summary

• Protein general information: P09913  
  • Name: Interferon induced protein with tetratricopeptide repeats 2 (IFIT 2) (ISG 54 K) (Interferon induced 54 kDa protein) (IFI 54K) (P54)
  • Length: 472  
  • Mass: 54632
• Sequence:

  MSENNKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKATMCNLLAYLKHLKGQNEAALECLR
  KAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDVQIYVDKVKHVCEKFSSPYRIESPELDCEEGWTRLKCG
  GNQNERAKVCFEKALEKKPKNPEFTSGLAIASYRLDNWPPSQNAIDPLRQAIRLNPDNQYLKVLLALKLHKMREE
  GEEEGEGEKLVEEALEKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYIPNNAYLHCQIGCCYRAKVFQVMN
  LRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHL
  RYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQAD
  EDSERGLESGSLIPSASSWNGE

• Structural information:
  • Interpro: IPR024124  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 4G1T
  • PDBsum: 4G1T
  • DIP: 48848
  • STRING: ENSP00000360891
• Other Databases: GeneCards:  IFIT2  Malacards:  IFIT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009615	response to virus	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0051607	defense response to virus	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009615	response to virus	IMP	biological process
GO:0008637	apoptotic mitochondrial changes	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035457	cellular response to interferon-alpha	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)