• Gene id: 343171

Gene Summary

• Gene Symbol: OR2W3   Gene   UCSC   Ensembl
• Aliases: OR2W3P, OR2W8P, OST718
• Gene name: olfactory receptor family 2 subfamily W member 3
• Alternate names: olfactory receptor 2W3, olfactory receptor 2W8, olfactory receptor OR1-49, olfactory receptor, family 2, subfamily W, member 3 pseudogene, olfactory receptor, family 2, subfamily W, member 8 pseudogene,
• Gene location: 1q44 (247895586: 247896530)     Exons: 1     NC_000001.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 616729

SNPs

rs11204546

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.247896410T>A
NC_000001.11   g.247896410T>C
NC_000001.11   g.247896410T>G
NC_000001.10   g.248059712T>A
NC_000001.10   g.248059712T>C
NC_000001.10   g.248059712T>G
NG_053132.1   g.5824T>A
NG_053132.1   g.5824T>C
NG_053132.1   g.5824T>G
NM_001001957.2   c

Protein Summary

• Protein general information: Q7Z3T1  
  • Name: Olfactory receptor 2W3 (Olfactory receptor 2W8) (Olfactory receptor OR1 49)
  • Length: 314  
  • Mass: 34,789
• Sequence:

  MDGTNGSTQTHFILLGFSDRPHLERILFVVILIAYLLTLVGNTTIILVSRLDPHLHTPMYFFLAHLSFLDLSFTT
  SSIPQLLYNLNGCDKTISYMGCAIQLFLFLGLGGVECLLLAVMAYDRCVAICKPLHYMVIMNPRLCRGLVSVTWG
  CGVANSLAMSPVTLRLPRCGHHEVDHFLREMPALIRMACVSTVAIEGTVFVLAVGVVLSPLVFILLSYSYIVRAV
  LQIRSASGRQKAFGTCGSHLTVVSLFYGNIIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGA
  LGRLLLGKRELGKE

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000353516
• Other Databases: GeneCards:  OR2W3  Malacards:  OR2W3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007608	sensory perception of smell	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007608	sensory perception of smell	IBA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007608	sensory perception of smell	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 25374392
Male factor infertility	MIK: 27172637
Azoospermia	MIK: 22016351
Oligozoospermia	MIK: 25847845
Azoospermia	MIK: 22016351
Oligozoospermia	MIK: 22016351
Male infertility	MIK: 27172637
Non-obstruction azoospermia	MIK: 25374392

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22016351	Azoospermia, Oligozoospermia	SNPs rs5911500 in LOC203413, rs3088232 in BRDT, and rs11204546 in OR2W3	Macedon ians, A lbanian s	297 (136 men with idiopathic infertility (60 azoospermic and 76 oligozoospermic), 161 fertile controls)	Male infertility	FASLG JMJDIA LOC203413 TEX15 BRDT OR2W3 INSR and TAS2R38
27172637	Male infertility	T132903C in INSR, C109869T in SLC6A14, T824C in OR2W3, T886C in TAS2R38	Persian (Irani an)	196 (96 idiopathic infertile male patients, 100 normal fertile men (controls))	Male infertility	INSR SLC6A14 OR2W3 TAS2R38
25374392	Non-obstruction azoospermia (NOA)	USF1 (rs1556259, rs2516838, and rs2774276), OR2W3 (rs11204546), GTF2A1L (rs11677854)	Chinese Han	729 (361 NOA cases, 368 controls)	Male infertility	USF1  GTF2A1L and OR2W3
25847845	Male infertility, Azoospermia, Oligozoospermia	(rs5911500, rs10246939, rs2059807, and rs11204546	Japanes e	886 (517 Japanese patients with male infertility, 369 fertile controls)	Male infertility
20378615	Oligozoospermia or azoospermia	rs11204546	Europea n	442 (158 normospermic controls, 63 moderately oligozoospermic samples, 141 severe oligozoospermic samples and 80 non-obstructed azoospermic samples)	Male infertility	GWAS