• Gene id: 342977

Gene Summary

• Gene Symbol: NANOS3   Gene   UCSC   Ensembl
• Aliases: NANOS1L, NOS3, ZC2HC12C
• Gene name: nanos C2HC-type zinc finger 3
• Alternate names: nanos homolog 3,
• Gene location: 19p13.12 (13862062: 13880756)     Exons: 4     NC_000019.10
• OMIM: 608229

Protein Summary

• Protein general information: P60323  
  • Name: Nanos homolog 3 (NOS 3)
  • Length: 173  
  • Mass: 18,844
• Sequence:

  MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPDQKRSLESSPAPERLCSFCKHNGESRAIYQSHV
  LKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPLTGQGYTSVYSHTTRNSAGKKLVRPDKAKTQDTGHRRGGG
  GGAGFRGAGKSEPSPSCSPSMST

• Structural information:
  • Interpro: IPR008705  IPR038129  IPR024161  
  • Prosite: PS51522
• Other Databases: GeneCards:  NANOS3  Malacards:  NANOS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	ISS	cellular component
GO:0003723	RNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006417	regulation of translation	ISS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007281	germ cell development	IMP	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048477	oogenesis	IEA	biological process
GO:0051726	regulation of cell cycle	ISS	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0000932	P-body	ISS	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	ISS	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0006417	regulation of translation	ISS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007281	germ cell development	IMP	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048477	oogenesis	IEA	biological process
GO:0048477	oogenesis	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	ISS	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:0000932	P-body	ISS	cellular component
GO:0003723	RNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006417	regulation of translation	ISS	biological process
GO:0007281	germ cell development	IMP	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051726	regulation of cell cycle	ISS	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process

Diseases

Associated diseases	References
Premature ovarian insufficiency (POI)	INFBASE: 24091668
Premature ovarian failure (POF)	INFBASE: 17418157
Sterility	MIK: 19565640
Male factor infertility	MIK: 19565640
Sterility	MIK: 19565640

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19565640	Sterility				Male infertility	NANOS3