• Gene id: 3429

Gene Summary

• Gene Symbol: IFI27   Gene   UCSC   Ensembl
• Aliases: FAM14D, ISG12, ISG12A, P27
• Gene name: interferon alpha inducible protein 27
• Alternate names: interferon alpha-inducible protein 27, mitochondrial, 2310061N23Rik, ISG12(a), interferon alpha-induced 11.5 kDa protein, interferon-stimulated gene 12a protein,
• Gene location: 14q32.12 (94110735: 94116689)     Exons: 6     NC_000014.9
• OMIM: 616874

Protein Summary

• Protein general information: P40305  
  • Name: Interferon alpha inducible protein 27, mitochondrial (p27) (Interferon alpha induced 11.5 kDa protein) (Interferon stimulated gene 12a protein) (ISG12(a)) (ISG12A)
  • Length: 122  
  • Mass: 11542
• Sequence:

  MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAA
  IANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

• Structural information:
  • Interpro: IPR009311  IPR038213  
  • STRING: ENSP00000483430
• Other Databases: GeneCards:  IFI27  Malacards:  IFI27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0006915	apoptotic process	IDA	biological process
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0060337	type I interferon signaling pathway	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0044827	modulation by host of viral genome replication	IMP	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005637	nuclear inner membrane	IDA	cellular component
GO:0005521	lamin binding	IDA	molecular function
GO:0046825	regulation of protein export from nucleus	IGI	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IGI	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R