• Gene id: 3428

Gene Summary

• Gene Symbol: IFI16   Gene   UCSC   Ensembl
• Aliases: IFNGIP1, PYHIN2
• Gene name: interferon gamma inducible protein 16
• Alternate names: gamma-interferon-inducible protein 16, IFI16 beta isoform, interferon-gamma induced protein IFI 16, interferon-inducible myeloid differentiation transcriptional activator,
• Gene location: 1q23.1 (158999975: 159055150)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein
• OMIM: 300976

Protein Summary

• Protein general information: Q16666  
  • Name: Gamma interferon inducible protein 16 (Ifi 16) (Interferon inducible myeloid differentiation transcriptional activator)
  • Length: 785  
  • Mass: 88256
  • Tissue specificity: Expressed in peripheral blood leukocytes, fibroblasts and lymphoid cells. Present in myeloid precursors (CD34+) and throughout monocyte development, but its expression is down-regulated in erythroid and polymorphonuclear precursor cell
• Sequence:

  MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFEDIPTL
  EDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQ
  PPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEK
  KIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
  TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQM
  SKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTTPSSSFFTKKSEDTIS
  KMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPG
  PFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
  HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKI
  NQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGEL
  RSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

• Structural information:
  • Protein Domains: (1..8-)
    (/note="Pyrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00061-)
    (189..38-)
    (/note="HIN-200-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00106-)
    (562..76-)
    (/note="HIN-200-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00106"-)
  • Interpro: IPR004020  IPR040205  IPR004021  
  • Prosite: PS50824 PS50834
  • PDB: 2OQ0 3B6Y 3RLN 3RLO 3RNU 4QGU
  • PDBsum: 2OQ0 3B6Y 3RLN 3RLO 3RNU 4QGU
  • DIP: 42868
  • STRING: ENSP00000357113
• Other Databases: GeneCards:  IFI16  Malacards:  IFI16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0002218	activation of innate immune response	IBA	biological process
GO:0032731	positive regulation of interleukin-1 beta production	IBA	biological process
GO:0035458	cellular response to interferon-beta	IBA	biological process
GO:0045824	negative regulation of innate immune response	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0042149	cellular response to glucose starvation	IDA	biological process
GO:2000117	negative regulation of cysteine-type endopeptidase activity	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0032731	positive regulation of interleukin-1 beta production	IDA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0008134	transcription factor binding	IDA	molecular function
GO:0002218	activation of innate immune response	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0010506	regulation of autophagy	IEP	biological process
GO:0001819	positive regulation of cytokine production	TAS	biological process
GO:0040029	regulation of gene expression, epigenetic	IMP	biological process
GO:0005829	cytosol	IPI	colocalizes with
GO:0097202	activation of cysteine-type endopeptidase activity	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002218	activation of innate immune response	IEA	biological process
GO:0035458	cellular response to interferon-beta	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0030224	monocyte differentiation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0030099	myeloid cell differentiation	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq