• Gene id: 342538

Gene Summary

• Gene Symbol: NACA2   Gene   UCSC   Ensembl
• Aliases: ANAC, NACAL
• Gene name: nascent polypeptide associated complex subunit alpha 2
• Alternate names: nascent polypeptide-associated complex subunit alpha-2, IgE autoantigen alpha-nascent polypeptide-associated complex, alpha-NAC protein, hom s 2.01 protein, nascent polypeptide associated complex alpha subunit 2, nascent polypeptide-associated complex, alpha p,
• Gene location: 17q23.2 (61591218: 61590420)     Exons: 1     NC_000017.11
• OMIM: 609274

Protein Summary

• Protein general information: Q9H009  
  • Name: Nascent polypeptide associated complex subunit alpha 2 (Alpha NAC like) (Hom s 2.01) (Nascent polypeptide associated complex subunit alpha like) (NAC alpha like)
  • Length: 215  
  • Mass: 23223
  • Tissue specificity: Expressed specifically in testis and skeletal muscle. {ECO
• Sequence:

  MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKR
  ARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAV
  GNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV

• Structural information:
  • Protein Domains: (70..13-)
    (/note="NAC-A/B-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00507-)
    (176..21-)
    (/note="UBA"-)
  • Interpro: IPR016641  IPR038187  IPR002715  
  • Prosite: PS51151
  • STRING: ENSP00000427802
• Other Databases: GeneCards:  NACA2  Malacards:  NACA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005854	nascent polypeptide-associated complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881