• Gene id: 342510

Gene Summary

• Gene Symbol: CD300E   Gene   UCSC   Ensembl
• Aliases: CD300LE, CLM-2, CLM2, CMRF35-A5, IREM-2, IREM2, PIgR-2, PIgR2
• Gene name: CD300e molecule
• Alternate names: CMRF35-like molecule 2, CD300 antigen-like family member E, CD300e antigen, immune receptor expressed on myeloid cells 2, poly-Ig receptor 2, polymeric immunoglobulin receptor 2,
• Gene location: 17q25.1 (74623957: 74609884)     Exons: 5     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the CD300 glycoprotein family of cell surface proteins expressed on myeloid cells. The protein interacts with the TYRO protein tyrosine kinase-binding protein and is thought to act as an activating receptor. [provided by RefS
• OMIM: 608697

Protein Summary

• Protein general information: Q496F6  
  • Name: CMRF35 like molecule 2 (CLM 2) (CD300 antigen like family member E) (CMRF35 A5) (Immune receptor expressed on myeloid cells 2) (IREM 2) (Polymeric immunoglobulin receptor 2) (PIgR 2) (PIgR2) (Poly Ig receptor 2) (CD antigen CD300e)
  • Length: 205  
  • Mass: 22918
  • Tissue specificity: Present on the surface of mature hematopoietic cells of the monocyte and myeloid lineages (at protein level). {ECO
• Sequence:

  MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGR
  VSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPPIFLVVN
  PGRNLSTGEVLTQNSGFRLSSPHFLLVVLLKLPLLLSMLGAVFWVNRPQWAPPGR

• Structural information:
  • Protein Domains: (18..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000376395
• Other Databases: GeneCards:  CD300E  Malacards:  CD300E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq