• Gene id: 3422

Gene Summary

• Gene Symbol: IDI1   Gene   UCSC   Ensembl
• Aliases: IPP1, IPPI1
• Gene name: isopentenyl-diphosphate delta isomerase 1
• Alternate names: isopentenyl-diphosphate Delta-isomerase 1, IPP isomerase 1, isopentenyl diphosphate dimethylallyl diphosphate isomerase 1, isopentenyl pyrophosphate isomerase 1,
• Gene location: 10p15.3 (1056703: 1039151)     Exons: 8     NC_000010.11
• Gene summary(Entrez): IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in t
• OMIM: 604055

Protein Summary

• Protein general information: Q13907  
  • Name: Isopentenyl diphosphate Delta isomerase 1 (EC 5.3.3.2) (Isopentenyl pyrophosphate isomerase 1) (IPP isomerase 1) (IPPI1)
  • Length: 227  
  • Mass: 26319
• Sequence:

  MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKI
  TFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEID
  YILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIY
  RM

• Structural information:
  • Protein Domains: (49..19-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR011876  IPR015797  IPR000086  
  • Prosite: PS51462
  • CDD: cd02885
  • PDB: 2DHO 2I6K 2ICJ 2ICK
  • PDBsum: 2DHO 2I6K 2ICJ 2ICK
  • STRING: ENSP00000370748
• Other Databases: GeneCards:  IDI1  Malacards:  IDI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004452	isopentenyl-diphosphate delta-isomerase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0009240	isopentenyl diphosphate biosynthetic process	IBA	biological process
GO:0004452	isopentenyl-diphosphate delta-isomerase activity	IEA	molecular function
GO:0008299	isoprenoid biosynthetic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006695	cholesterol biosynthetic process	IEA	biological process
GO:0008299	isoprenoid biosynthetic process	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0016126	sterol biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0004452	isopentenyl-diphosphate delta-isomerase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006695	cholesterol biosynthetic process	TAS	biological process
GO:0045540	regulation of cholesterol biosynthetic process	TAS	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0050992	dimethylallyl diphosphate biosynthetic process	IEA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00900	Terpenoid backbone biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881