• Gene id: 341567

Gene Summary

• Gene Symbol: H1FNT   Gene   UCSC   Ensembl
• Aliases: H1.7, H1T2
• Gene name: H1 histone family member N, testis specific
• Alternate names: testis-specific H1 histone, HANP1, haploid germ cell-specific nuclear protein 1, histone H1t2, testis secretory sperm-binding protein Li 223n,
• Gene location: 12q13.11 (48328979: 48330278)     Exons: 1     NC_000012.12
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
• OMIM: 0

Protein Summary

• Protein general information: Q75WM6  
  • Name: Testis specific H1 histone (Haploid germ cell specific nuclear protein 1) (Histone H1t2)
  • Length: 255  
  • Mass: 28,116
• Sequence:

  MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLT
  LAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYFRVWKVPKPRRKPGRARQEEGTRAPWRTPAA
  PRSSRRRRQPLRKAARKAREVWRRNARAKAKANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQAVKEDT
  TPRSGKDKRRSSKPREEKQEPKKPAQRTIQ

• Structural information:
  • Interpro: IPR036388  
  • STRING: ENSP00000334805
• Other Databases: GeneCards:  H1FNT  Malacards:  H1FNT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007290	spermatid nucleus elongation	ISS	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007290	spermatid nucleus elongation	IEA	biological process
GO:0007290	spermatid nucleus elongation	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0035092	sperm chromatin condensation	IEA	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process
GO:0000790	nuclear chromatin	ISS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007290	spermatid nucleus elongation	ISS	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 16533358
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 16533358
Spermatogenic defects	MIK: 15710904

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16533358	Male infertility		Japanes e		Male infertility
15710904	Required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray