• Gene id: 341359

Gene Summary

• Gene Symbol: SYT10   Gene   UCSC   Ensembl
• Gene name: synaptotagmin 10
• Alternate names: synaptotagmin-10, synaptotagmin X, sytX,
• Gene location: 12p11.1 (33439818: 33374237)     Exons: 8     NC_000012.12
• OMIM: 136535

Protein Summary

• Protein general information: Q6XYQ8  
  • Name: Synaptotagmin 10 (Synaptotagmin X) (SytX)
  • Length: 523  
  • Mass: 59127
  • Tissue specificity: Expressed only in pancreas, lung and kidney. {ECO
• Sequence:

  MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVVVSFCGLALLVVSLFV
  FWKLCWPCWKSKPVTSNITTLPQSISSAPTEVFETEEKKEIKENEKPAVKAIEPAIKISHTSPDIPAEVQTALKE
  HLIKHARVQRQITEPTSSTRHSSFRRHLPRQMQVSSVDFSMGTEPVLQRGETTTSIGRIKPELYKQKSVDSEGNQ
  NEDVKICGKLNFTLQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETF
  QFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTESIDLGEIMFSLCYLP
  TAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTTTKKNTLNPVYNEAIIFDIPPENVDQVSLSI
  AVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCPSPKPPSTP

• Structural information:
  • Protein Domains: (231..35-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (363..49-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041"-)
  • Interpro: IPR000008  IPR035892  IPR001565  IPR028677  
  • Prosite: PS50004
  • STRING: ENSP00000228567
• Other Databases: GeneCards:  SYT10  Malacards:  SYT10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0001786	phosphatidylserine binding	IBA	molecular function
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0014059	regulation of dopamine secretion	IBA	biological process
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0017156	calcium-ion regulated exocytosis	IBA	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IBA	biological process
GO:0048791	calcium ion-regulated exocytosis of neurotransmitter	IBA	biological process
GO:0000149	SNARE binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0019905	syntaxin binding	IBA	molecular function
GO:0030276	clathrin binding	IBA	molecular function
GO:0070382	exocytic vesicle	IBA	cellular component
GO:0005509	calcium ion binding	ISS	molecular function
GO:0045956	positive regulation of calcium ion-dependent exocytosis	ISS	biological process
GO:0016079	synaptic vesicle exocytosis	ISS	NOT|biological process
GO:0007268	chemical synaptic transmission	ISS	biological process
GO:0070382	exocytic vesicle	ISS	cellular component
GO:0007608	sensory perception of smell	ISS	biological process
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0017158	regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0070382	exocytic vesicle	IEA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0000149	SNARE binding	IEA	molecular function
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq