• Gene id: 341116

Gene Summary

• Gene Symbol: MS4A10   Gene   UCSC   Ensembl
• Aliases: CD20L7, MS4A9
• Gene name: membrane spanning 4-domains A10
• Alternate names: membrane-spanning 4-domains subfamily A member 10, CD20 antigen-like 7, membrane-spanning 4-domains, subfamily A, member 10,
• Gene location: 11q12.2 (60785331: 60801304)     Exons: 9     NC_000011.10
• Gene summary(Entrez): Most MS4A genes, including MS4A10, encode proteins with at least 4 potential transmembrane domains and N- and C-terminal cytoplasmic domains encoded by distinct exons.[supplied by OMIM, Apr 2004]
• OMIM: 608403

Protein Summary

• Protein general information: Q96PG2  
  • Name: Membrane spanning 4 domains subfamily A member 10 (CD20 antigen like 7)
  • Length: 267  
  • Mass: 29747
• Sequence:

  MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKELGAFHITIALLHLVFG
  GYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYLKMLCLMTNLISLFCVLSGLFVISKDLFLES
  PFESPIWRMYPNSTVHIQRLELALLCFTVLELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPS
  YQSVIQGDAQHKQHQRLREVKQVAPDTWIVTDGAAIWTQTAN

• Structural information:
  • Interpro: IPR007237  IPR030417  
  • STRING: ENSP00000311862
• Other Databases: GeneCards:  MS4A10  Malacards:  MS4A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)