• Gene id: 340602

Gene Summary

• Gene Symbol: EZHIP   Gene   UCSC   Ensembl
• Aliases: CATACOMB, CXorf67, KIP75
• Gene name: EZH inhibitory protein
• Alternate names: EZH inhibitory protein, K27M-like inhibitor of PRC2, catalytic antagonist of Polycomb, uncharacterized protein CXorf67,
• Gene location: Xp11.22 (51406947: 51408842)     Exons: 1     NC_000023.11

Protein Summary

• Protein general information: Q86X51  
  • Name: EZH inhibitory protein
  • Length: 503  
  • Mass: 51894
• Sequence:

  MATQSDMEKEQKHQQDEGQGGLNNETALASGDACGTGNQDPAASVTTVSSQASPSGGAALSSSTAGSSAAAATSA
  AIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQ
  PCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGASTSSQATQPGPALLSHASEARPATRSRITLVASALR
  RRASGPGPVIRGCTAQPGPAFPHRATHLDPARLSPESAPGPARRGRASVPGPARRGCDSAPGPARRGRDSAPVSA
  PRGRDSAPGSARRGRDSAPGPALRVRTARSDAGHRSTSTTPGTGLRSRSTQQRSALLSRRSLSGSADENPSCGTG
  SERLAFQSRSGSPDPEVPSRASPPVWHAVRMRASSPSPPGRFFLPIPQQWDESSSSSYASNSSSPSRSPGLSPSS
  PSPEFLGLRSISTPSPESLRYALMPEFYALSPVPPEEQAEIESTAHPATPPEP

• Structural information:
  • STRING: ENSP00000342680
• Other Databases: GeneCards:  EZHIP  Malacards:  EZHIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0061086	negative regulation of histone H3-K27 methylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0061086	negative regulation of histone H3-K27 methylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881