• Gene id: 340547

Gene Summary

• Gene Symbol: VSIG1   Gene   UCSC   Ensembl
• Aliases: 1700062D20Rik, GPA34, dJ889N15.1
• Gene name: V-set and immunoglobulin domain containing 1
• Alternate names: V-set and immunoglobulin domain-containing protein 1, cell surface A33 antigen, glycoprotein A34,
• Gene location: Xq22.3 (108018885: 108079183)     Exons: 10     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the junctional adhesion molecule (JAM) family. The encoded protein contains multiple glycosylation sites at the N-terminal region, and multiple phosphorylation sites and glutamic acid/proline (EP) repeats at the C-terminal re
• OMIM: 300620

Protein Summary

• Protein general information: Q86XK7  
  • Name: V set and immunoglobulin domain containing protein 1 (Cell surface A33 antigen) (Glycoprotein A34)
  • Length: 387  
  • Mass: 41811
  • Tissue specificity: Detected only in stomach mucosa and testis, and to a much lesser level in pancreas (at protein level). Detected in gastric cancers (31%), esophageal carcinomas (50%) and ovarian cancers (23%). {ECO
• Sequence:

  MVFAFWKVFLILSCLAGQVSVVQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFS
  QGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGR
  PETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEID
  LTSSHPEVGIIVGALIGSLVGAAIIISVVCFARNKAKAKAKERNSKTIAELEPMTKINPRGESEAMPREDATQLE
  VTLPSSIHETGPDTIQEPDYEPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVE
  PLSEDEKGVVKA

• Structural information:
  • Protein Domains: (22..13-)
    (/note="Ig-like-V-type)
    (140..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR000920  IPR029861  
  • Prosite: PS50835
  • STRING: ENSP00000402219
• Other Databases: GeneCards:  VSIG1  Malacards:  VSIG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0030277	maintenance of gastrointestinal epithelium	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030277	maintenance of gastrointestinal epithelium	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)