• Gene id: 340543

Gene Summary

• Gene Symbol: TCEAL5   Gene   UCSC   Ensembl
• Aliases: WEX4
• Gene name: transcription elongation factor A like 5
• Alternate names: transcription elongation factor A protein-like 5, TCEA-like protein 5, transcription elongation factor A (SII)-like 5, transcription elongation factor S-II protein-like 5,
• Gene location: Xq22.1 (103276749: 103273690)     Exons: 3     NC_000023.11
• Gene summary(Entrez): This gene, which is located on the X chromosome, encodes a protein which contains a BEX (brain expressed X-liked like family) domain. This domain is found in proteins encoded by the TCEAL elongation factor (transcription elongation factor A (SII)-like) ge

Protein Summary

• Protein general information: Q5H9L2  
  • Name: Transcription elongation factor A protein like 5 (TCEA like protein 5) (Transcription elongation factor S II protein like 5)
  • Length: 206  
  • Mass: 23307
• Sequence:

  MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTECEGKREDEGEPGDEGQLEDEGNQEKQ
  GKSEGEDKPQSEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECG
  DVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDLEDVPYV

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361765
• Other Databases: GeneCards:  TCEAL5  Malacards:  TCEAL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq