• Gene id: 340481

Gene Summary

• Gene Symbol: ZDHHC21   Gene   UCSC   Ensembl
• Aliases: DHHC-21, DHHC21, DNZ1, HSPC097
• Gene name: zinc finger DHHC-type palmitoyltransferase 21
• Alternate names: palmitoyltransferase ZDHHC21, zinc finger DHHC-type containing 21, zinc finger, DHHC domain containing 21,
• Gene location: 9p22.3 (14693431: 14588796)     Exons: 35     NC_000009.12
• OMIM: 614605

Protein Summary

• Protein general information: Q8IVQ6  
  • Name: Palmitoyltransferase ZDHHC21 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 21) (DHHC 21)
  • Length: 265  
  • Mass: 31385
• Sequence:

  MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASITDPGRL
  PENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYAL
  MFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRP
  RKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV

• Structural information:
  • Protein Domains: (90..14-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000370303
• Other Databases: GeneCards:  ZDHHC21  Malacards:  ZDHHC21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0016409	palmitoyltransferase activity	TAS	molecular function
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001942	hair follicle development	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0018345	protein palmitoylation	IEA	biological process
GO:0048733	sebaceous gland development	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881