• Gene id: 340419

Gene Summary

• Gene Symbol: RSPO2   Gene   UCSC   Ensembl
• Aliases: CRISTIN2, HHRRD, TETAMS2
• Gene name: R-spondin 2
• Alternate names: R-spondin-2, R-spondin 2 homolog, roof plate-specific spondin-2,
• Gene location: 8q23.1 (108083679: 107899315)     Exons: 28     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the R-spondin family of proteins. These proteins are secreted ligands of leucine-rich repeat containing G protein-coupled receptors that enhance Wnt signaling through the inhibition of ubiquitin E3 ligases. A chromosomal tran
• OMIM: 610575

Protein Summary

• Protein general information: Q6UXX9  
  • Name: R spondin 2 (Roof plate specific spondin 2) (hRspo2)
  • Length: 243  
  • Mass: 28315
• Sequence:

  MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECL
  HSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHW
  SEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTPKAKEKRNKKKKRKLI
  ERAQEQHSVFLATDRANQ

• Structural information:
  • Protein Domains: (144..20-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210"-)
  • Interpro: IPR006212  IPR009030  IPR042993  IPR000884  IPR036383  
  • Prosite: PS50092
  • CDD: cd00064
  • STRING: ENSP00000276659
• Other Databases: GeneCards:  RSPO2  Malacards:  RSPO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	NAS	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	NAS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IDA	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0060173	limb development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030177	positive regulation of Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0060437	lung growth	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0030282	bone mineralization	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0035116	embryonic hindlimb morphogenesis	IEA	biological process
GO:0042489	negative regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0060535	trachea cartilage morphogenesis	IEA	biological process
GO:0071542	dopaminergic neuron differentiation	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)