About Us

Search Result


Gene id 340385
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF517   Gene   UCSC   Ensembl
Gene name zinc finger protein 517
Alternate names zinc finger protein 517,
Gene location 8q24.3 (144798875: 144813136)     Exons: 7     NC_000008.11
OMIM 604731

Protein Summary

Protein general information Q6ZMY9  

Name: Zinc finger protein 517

Length: 492  Mass: 54711

Sequence MAMALPMPGPQEAVVFEDVAVYFTRIEWSCLAPDQQALYRDVMLENYGNLASLGFLVAKPALISLLEQGEEPGAL
ILQVAEQSVAKASLCTDSRMEAGIMESPLQRKLSRQAGLPGTVWGCLPWGHPVGGHPAPPHPHGGPEDGSDKPTH
PRAREHSASPRVLQEDLGRPVGSSAPRYRCVCGKAFRYNSLLLRHQIIHTGAKPFQCTECGKAFKQSSILLRHQL
IHTEEKPFQCGECGKAFRQSTQLAAHHRVHTRERPYACGECGKAFSRSSRLLQHQKFHTGEKPFACTECGKAFCR
RFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGVGQGALLGAAQRPQAGDPPHECPVCGR
PFRHNSLLLLHLRLHTGEKPFECAECGKAFGRKSNLTLHQKIHTKEKPFACTECGKAFRRSYTLNEHYRLHSGER
PYRCRACGRACSRLSTLIQHQKVHGREPGEDTEGRRAPCWAS
Structural information
Protein Domains
(14..8-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000353058
Other Databases GeneCards:  ZNF517  Malacards:  ZNF517

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0006357 regulation of transcripti
on by RNA polymerase II
IBA biological process
GO:0000977 RNA polymerase II transcr
iption regulatory region
sequence-specific DNA bin
ding
IBA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006357 regulation of transcripti
on by RNA polymerase II
IBA biological process
GO:0000977 RNA polymerase II transcr
iption regulatory region
sequence-specific DNA bin
ding
IBA molecular function
GO:0005634 nucleus
IBA cellular component
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract