• Gene id: 340168

Gene Summary

• Gene Symbol: DPPA5   Gene   UCSC   Ensembl
• Aliases: ESG1
• Gene name: developmental pluripotency associated 5
• Alternate names: developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1,
• Gene location: 6q13 (75915154: 75986854)     Exons: 17     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and
• OMIM: 611111

Protein Summary

• Protein general information: A6NC42  
  • Name: Developmental pluripotency associated 5 protein (hDPPA5) (Embryonal stem cell specific gene 1 protein) (ESG 1)
  • Length: 116  
  • Mass: 13498
• Sequence:

  MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVVYGSYL
  YKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK

• Structural information:
  • Protein Domains: (23..8-)
    (/note="K-)
    (-)
  • Interpro: IPR036612  IPR031952  
  • CDD: cd12795
  • STRING: ENSP00000359396
• Other Databases: GeneCards:  DPPA5  Malacards:  DPPA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0010468	regulation of gene expression	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)