• Gene id: 340069

Gene Summary

• Gene Symbol: FAM170A   Gene   UCSC   Ensembl
• Aliases: ZNFD
• Gene name: family with sequence similarity 170 member A
• Alternate names: protein FAM170A, Znf domain containing protein, zinc finger domain-containing protein, zinc finger protein ZNFD,
• Gene location: 5q23.1 (119629557: 119635821)     Exons: 5     NC_000005.10
• OMIM: 618401

Protein Summary

• Protein general information: A1A519  
  • Name: Protein FAM170A (Zinc finger domain containing protein) (Zinc finger protein ZNFD)
  • Length: 330  
  • Mass: 37158
  • Tissue specificity: Expressed strongly in testis and brain and weakly in prostate, spleen, pancreas and uterus. {ECO
• Sequence:

  MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRI
  HRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLE
  SLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTME
  NGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEE
  GQPTEEDLGLRRSWSQCPGCVFHSPKDRNS

• Structural information:
  • Interpro: IPR033376  IPR040879  
  • STRING: ENSP00000482552
• Other Databases: GeneCards:  FAM170A  Malacards:  FAM170A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0006366	transcription by RNA polymerase II	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq