• Gene id: 340061

Gene Summary

• Gene Symbol: STING1   Gene   UCSC   Ensembl
• Aliases: ERIS, MITA, MPYS, NET23, SAVI, STING, STING-beta, TMEM173, hMITA, hSTING
• Gene name: stimulator of interferon response cGAMP interactor 1
• Alternate names: stimulator of interferon genes protein, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, endoplasmic reticulum IFN stimulator, endoplasmic reticulum interferon stimulator, mitochondrial mediator of IRF3 activation, stimulator of inte,
• Gene location: 5q31.2 (139482757: 139475532)     Exons: 9     NC_000005.10
• Gene summary(Entrez): This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits si

Protein Summary

• Protein general information: Q86WV6  
  • Name: Stimulator of interferon genes protein (hSTING) (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (hMITA) (Transmembrane protein 173)
  • Length: 379  
  • Mass: 42193
  • Tissue specificity: Ubiquitously expressed. Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages. {ECO
• Sequence:

  MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHS
  RYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEK
  GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKL
  PQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILA
  DAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLR
  TDFS

• Structural information:
  • Interpro: IPR029158  IPR033952  IPR038623  
  • CDD: cd12146
  • PDB: 4EF4 4EF5 4EMT 4EMU 4F5D 4F5E 4F5W 4F5Y 4F9E 4F9G 4KSY 4LOH 4LOI 4QXO 4QXP 4QXQ 4QXR 5BQX 5JEJ 6CFF 6CY7 6DNK 6DXG 6DXL 6MX0 6MX3 6MXE 6NT5 6O8B 6O8C 6RM0 6S26 6S27 6S86
  • PDBsum: 4EF4 4EF5 4EMT 4EMU 4F5D 4F5E 4F5W 4F5Y 4F9E 4F9G 4KSY 4LOH 4LOI 4QXO 4QXP 4QXQ 4QXR 5BQX 5JEJ 6CFF 6CY7 6DNK 6DXG 6DXL 6MX0 6MX3 6MXE 6NT5 6O8B 6O8C 6RM0 6S26 6S27 6S86
  • DIP: 48847
  • STRING: ENSP00000331288
• Other Databases: GeneCards:  STING1  Malacards:  STING1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061709	reticulophagy	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0035438	cyclic-di-GMP binding	IBA	molecular function
GO:0016239	positive regulation of macroautophagy	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0061507	cyclic-GMP-AMP binding	IBA	molecular function
GO:0032481	positive regulation of type I interferon production	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0002218	activation of innate immune response	IBA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0035438	cyclic-di-GMP binding	IDA	molecular function
GO:0032608	interferon-beta production	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0045087	innate immune response	IDA	biological process
GO:0032608	interferon-beta production	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0035438	cyclic-di-GMP binding	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:1990701	integral component of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0000045	autophagosome assembly	IDA	biological process
GO:0000045	autophagosome assembly	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0045087	innate immune response	IMP	biological process
GO:0032608	interferon-beta production	IMP	biological process
GO:0061709	reticulophagy	ISS	biological process
GO:0061507	cyclic-GMP-AMP binding	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035438	cyclic-di-GMP binding	IEA	molecular function
GO:0002218	activation of innate immune response	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016239	positive regulation of macroautophagy	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0032608	interferon-beta production	IEA	biological process
GO:0035438	cyclic-di-GMP binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0061709	reticulophagy	IEA	biological process
GO:0000045	autophagosome assembly	IEA	biological process
GO:0002218	activation of innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0031323	regulation of cellular metabolic process	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0035458	cellular response to interferon-beta	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0061507	cyclic-GMP-AMP binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0061507	cyclic-GMP-AMP binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0002218	activation of innate immune response	IMP	biological process
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061709	reticulophagy	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0035438	cyclic-di-GMP binding	IBA	molecular function
GO:0016239	positive regulation of macroautophagy	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0000045	autophagosome assembly	IBA	biological process
GO:0061507	cyclic-GMP-AMP binding	IBA	molecular function
GO:0032481	positive regulation of type I interferon production	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0002218	activation of innate immune response	IBA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0035438	cyclic-di-GMP binding	IDA	molecular function
GO:0032608	interferon-beta production	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0045087	innate immune response	IDA	biological process
GO:0032608	interferon-beta production	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0035438	cyclic-di-GMP binding	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:1990701	integral component of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0032481	positive regulation of type I interferon production	IDA	biological process
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0061507	cyclic-GMP-AMP binding	IDA	molecular function
GO:0000045	autophagosome assembly	IDA	biological process
GO:0000045	autophagosome assembly	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0045087	innate immune response	IMP	biological process
GO:0032608	interferon-beta production	IMP	biological process
GO:0061709	reticulophagy	ISS	biological process
GO:0061507	cyclic-GMP-AMP binding	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035438	cyclic-di-GMP binding	IEA	molecular function
GO:0002218	activation of innate immune response	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016239	positive regulation of macroautophagy	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0032608	interferon-beta production	IEA	biological process
GO:0035438	cyclic-di-GMP binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0061709	reticulophagy	IEA	biological process
GO:0000045	autophagosome assembly	IEA	biological process
GO:0002218	activation of innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0031323	regulation of cellular metabolic process	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0035458	cellular response to interferon-beta	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0061507	cyclic-GMP-AMP binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0061507	cyclic-GMP-AMP binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0002218	activation of innate immune response	IMP	biological process
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0071360	cellular response to exogenous dsRNA	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05131	Shigellosis
hsa05163	Human cytomegalovirus infection
hsa05170	Human immunodeficiency virus 1 infection
hsa04621	NOD-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
STING-associated vasculopathy with onset in infancy	KEGG:H01746
STING-associated vasculopathy with onset in infancy	KEGG:H01746
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R