• Gene id: 3400

Gene Summary

• Gene Symbol: ID4   Gene   UCSC   Ensembl
• Aliases: IDB4, bHLHb27
• Gene name: inhibitor of DNA binding 4, HLH protein
• Alternate names: DNA-binding protein inhibitor ID-4, class B basic helix-loop-helix protein 27, inhibitor of DNA binding 4, dominant negative helix-loop-helix protein, inhibitor of differentiation 4,
• Gene location: 6p22.3 (19837369: 19842196)     Exons: 3     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This prote
• OMIM: 600581

Protein Summary

• Protein general information: P47928  
  • Name: DNA binding protein inhibitor ID 4 (Class B basic helix loop helix protein 27) (bHLHb27) (Inhibitor of DNA binding 4) (Inhibitor of differentiation 4)
  • Length: 161  
  • Mass: 16622
• Sequence:

  MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRL
  RRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGA
  VNKQGDSILCR

• Structural information:
  • Protein Domains: (52..10-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR026052  IPR036638  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000367972
• Other Databases: GeneCards:  ID4  Malacards:  ID4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140416	DNA-binding transcription factor inhibitor activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0032922	circadian regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0021895	cerebral cortex neuron differentiation	IEA	biological process
GO:0022010	central nervous system myelination	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060512	prostate gland morphogenesis	IEA	biological process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological process
GO:0060741	prostate gland stromal morphogenesis	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IEA	molecular function
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0007405	neuroblast proliferation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0048712	negative regulation of astrocyte differentiation	IEA	biological process
GO:0048715	negative regulation of oligodendrocyte differentiation	IEA	biological process
GO:0061682	seminal vesicle morphogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IC	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)