• Gene id: 3399

Gene Summary

• Gene Symbol: ID3   Gene   UCSC   Ensembl
• Aliases: HEIR-1, bHLHb25
• Gene name: inhibitor of DNA binding 3, HLH protein
• Alternate names: DNA-binding protein inhibitor ID-3, ID-like protein inhibitor HLH 1R21, class B basic helix-loop-helix protein 25, helix-loop-helix protein HEIR-1, inhibitor of DNA binding 3, dominant negative helix-loop-helix protein, inhibitor of differentiation 3,
• Gene location: 1p36.12 (23559500: 23557925)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it
• OMIM: 600277

Protein Summary

• Protein general information: Q02535  
  • Name: DNA binding protein inhibitor ID 3 (Class B basic helix loop helix protein 25) (bHLHb25) (Helix loop helix protein HEIR 1) (ID like protein inhibitor HLH 1R21) (Inhibitor of DNA binding 3) (Inhibitor of differentiation 3)
  • Length: 119  
  • Mass: 12999
  • Tissue specificity: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
• Sequence:

  MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVID
  YILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

• Structural information:
  • Protein Domains: (28..8-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR026052  IPR036638  
  • Prosite: PS50888
  • CDD: cd00083
  • PDB: 2LFH
  • PDBsum: 2LFH
  • DIP: 713
  • STRING: ENSP00000363689
• Other Databases: GeneCards:  ID3  Malacards:  ID3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140416	DNA-binding transcription factor inhibitor activity	TAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0032922	circadian regulation of gene expression	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0007517	muscle organ development	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0005634	nucleus	IC	cellular component
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0030903	notochord development	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0001656	metanephros development	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0006275	regulation of DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1901707	leptomycin B binding	IEA	molecular function
GO:0072750	cellular response to leptomycin B	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0042476	odontogenesis	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881