• Gene id: 3398

Gene Summary

• Gene Symbol: ID2   Gene   UCSC   Ensembl
• Aliases: GIG8, ID2A, ID2H, bHLHb26
• Gene name: inhibitor of DNA binding 2
• Alternate names: DNA-binding protein inhibitor ID-2, DNA-binding protein inhibitor ID2, cell growth-inhibiting gene 8, class B basic helix-loop-helix protein 26, helix-loop-helix protein ID2, inhibitor of DNA binding 2, HLH protein, inhibitor of DNA binding 2, dominant negative,
• Gene location: 2p25.1 (8682055: 8684460)     Exons: 3     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit th
• OMIM: 162080

SNPs

rs397515392

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.180661860C>G
NC_000003.11   g.180379648C>G
NG_029581.1   g.22636G>C|SEQ=[C/G]|GENE=CCDC39

Protein Summary

• Protein general information: Q02363  
  • Name: DNA binding protein inhibitor ID 2 (Class B basic helix loop helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)
  • Length: 134  
  • Mass: 14917
  • Tissue specificity: Highly expressed in early fetal tissues, including those of the central nervous system.
• Sequence:

  MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDL
  QIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

• Structural information:
  • Protein Domains: (23..7-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR026052  IPR036638  
  • Prosite: PS50888
  • CDD: cd00083
  • PDB: 4AYA
  • PDBsum: 4AYA
  • DIP: 46874
  • STRING: ENSP00000234091
• Other Databases: GeneCards:  ID2  Malacards:  ID2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001102	RNA polymerase II activating transcription factor binding	ISS	molecular function
GO:0140416	DNA-binding transcription factor inhibitor activity	TAS	molecular function
GO:0140416	DNA-binding transcription factor inhibitor activity	ISS	molecular function
GO:0005719	nuclear euchromatin	ISS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0051148	negative regulation of muscle cell differentiation	ISS	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0032922	circadian regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0045475	locomotor rhythm	ISS	biological process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IC	cellular component
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001656	metanephros development	IEA	biological process
GO:0002521	leukocyte differentiation	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0009649	entrainment of circadian clock	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0021772	olfactory bulb development	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological process
GO:0043153	entrainment of circadian clock by photoperiod	IEA	biological process
GO:0045475	locomotor rhythm	IEA	biological process
GO:0045578	negative regulation of B cell differentiation	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045648	positive regulation of erythrocyte differentiation	IEA	biological process
GO:0045651	positive regulation of macrophage differentiation	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048541	Peyer's patch development	IEA	biological process
GO:0048715	negative regulation of oligodendrocyte differentiation	IEA	biological process
GO:0060612	adipose tissue development	IEA	biological process
GO:0061030	epithelial cell differentiation involved in mammary gland alveolus development	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:1904797	negative regulation of core promoter binding	IEA	biological process
GO:2000177	regulation of neural precursor cell proliferation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0001966	thigmotaxis	IEA	biological process
GO:0003149	membranous septum morphogenesis	IEA	biological process
GO:0003166	bundle of His development	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0043353	enucleate erythrocyte differentiation	IEA	biological process
GO:0043392	negative regulation of DNA binding	IEA	biological process
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0048468	cell development	IEA	biological process
GO:0048469	cell maturation	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048663	neuron fate commitment	IEA	biological process
GO:0048667	cell morphogenesis involved in neuron differentiation	IEA	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0061031	endodermal digestive tract morphogenesis	IEA	biological process
GO:0071158	positive regulation of cell cycle arrest	IEA	biological process
GO:0090398	cellular senescence	IEA	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0071931	positive regulation of transcription involved in G1/S transition of mitotic cell cycle	IC	biological process
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2000177	regulation of neural precursor cell proliferation	ISS	biological process negative effect
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045777	positive regulation of blood pressure	ISS	biological process
GO:0032991	protein-containing complex	ISS	cellular component
GO:0033598	mammary gland epithelial cell proliferation	ISS	biological process
GO:0060749	mammary gland alveolus development	ISS	biological process
GO:0048663	neuron fate commitment	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	ISS	biological process
GO:0061030	epithelial cell differentiation involved in mammary gland alveolus development	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0090398	cellular senescence	ISS	biological process
GO:0071158	positive regulation of cell cycle arrest	ISS	biological process
GO:0061031	endodermal digestive tract morphogenesis	ISS	biological process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological process
GO:0045664	regulation of neuron differentiation	ISS	biological process negative effect
GO:0010629	negative regulation of gene expression	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa04390	Hippo signaling pathway
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881