• Gene id: 3396

Gene Summary

• Gene Symbol: MRPL58   Gene   UCSC   Ensembl
• Aliases: DS-1, DS1, ICT1, MRP-L58
• Gene name: mitochondrial ribosomal protein L58
• Alternate names: peptidyl-tRNA hydrolase ICT1, mitochondrial, 39S ribosomal protein L58, mitochondrial, digestion substraction 1, immature colon carcinoma transcript 1 protein, mitochondrial large ribosomal subunit protein ICT1, mitochondrial large ribosomal subunit protein mL,
• Gene location: 17q25.1 (75012669: 75021260)     Exons: 7     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be r
• OMIM: 603000

Protein Summary

• Protein general information: Q14197  
  • Name: Peptidyl tRNA hydrolase ICT1, mitochondrial (EC 3.1.1.29) (39S ribosomal protein L58, mitochondrial) (MRP L58) (Digestion substraction 1) (DS 1) (Immature colon carcinoma transcript 1 protein) (Mitochondrial large ribosomal subunit protein mL62)
  • Length: 206  
  • Mass: 23630
  • Tissue specificity: Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells. {ECO
• Sequence:

  MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLD
  RLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADC
  LQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD

• Structural information:
  • Interpro: IPR000352  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000301585
• Other Databases: GeneCards:  MRPL58  Malacards:  MRPL58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070126	mitochondrial translational termination	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0070126	mitochondrial translational termination	IDA	biological process
GO:0004045	aminoacyl-tRNA hydrolase activity	IDA	molecular function
GO:0016150	translation release factor activity, codon nonspecific	IDA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0003747	translation release factor activity	IEA	molecular function
GO:0006415	translational termination	IEA	biological process
GO:0005840	ribosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0004045	aminoacyl-tRNA hydrolase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)