• Gene id: 339559

Gene Summary

• Gene Symbol: ZFP69   Gene   UCSC   Ensembl
• Aliases: ZFP69A, ZKSCAN23A, ZNF642, ZSCAN54A
• Gene name: ZFP69 zinc finger protein
• Alternate names: zinc finger protein 69 homolog, ZFP69 zinc finger protein A, zinc finger protein 642, zinc finger protein ZFP69,
• Gene location: 1p34.2 (40477219: 40496342)     Exons: 6     NC_000001.11
• OMIM: 617939

Protein Summary

• Protein general information: Q49AA0  
  • Name: Zinc finger protein 69 homolog (Zinc finger protein 642)
  • Length: 526  
  • Mass: 61181
  • Tissue specificity: Expressed in visceral and subcutaneous adipose tissue. {ECO
• Sequence:

  MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDVKTQRESLEDEVTPGLPTAESQEL
  LTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLSKPSVISQLEKGEEPWMAEKEGPGDPSSDLK
  SKIETIESTAKSTISQERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETCMRDVRQAILTHKKRVQETNK
  FGENIIVHSNVIIEQRHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIFKQPIHLTEHMRIHTGEKPFR
  CKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQKAFSQNISLVQHLR
  THSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTFSHRAYLTHHQRIHTGERPYKCKECGKAFRQ
  RIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNK
  V

• Structural information:
  • Protein Domains: (1..3-)
    (/note="SCAN-box)
    (76..14-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR036236  IPR013087  
  • Prosite: PS50805 PS00028 PS50157
  • CDD: cd07765
  • STRING: ENSP00000361791
• Other Databases: GeneCards:  ZFP69  Malacards:  ZFP69

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)