• Gene id: 339487

Gene Summary

• Gene Symbol: ZBTB8OS   Gene   UCSC   Ensembl
• Aliases: ARCH, ARCH2
• Gene name: zinc finger and BTB domain containing 8 opposite strand
• Alternate names: protein archease, archease (ARCH), archease-like protein, zinc finger and BTB domain-containing opposite strand protein 8,
• Gene location: 1p35.1 (10730328: 10711083)     Exons: 8     NC_000017.11
• OMIM: 615891

Protein Summary

• Protein general information: Q8IWT0  
  • Name: Protein archease (Protein ZBTB8OS) (Zinc finger and BTB domain containing opposite strand protein 8)
  • Length: 167  
  • Mass: 19491
• Sequence:

  MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQT
  VEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGWGEEFSLSKHPQGTEVKAITYSA
  MQVYNEENPEVFVIIDI

• Structural information:
  • Interpro: IPR002804  IPR023572  IPR036820  
  • DIP: 61031
  • STRING: ENSP00000417677
• Other Databases: GeneCards:  ZBTB8OS  Malacards:  ZBTB8OS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072669	tRNA-splicing ligase complex	IBA	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IBA	biological process
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IDA	biological process
GO:0072669	tRNA-splicing ligase complex	IDA	cellular component
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881