• Gene id: 339403

Gene Summary

• Gene Symbol: RXFP4   Gene   UCSC   Ensembl
• Aliases: GPCR142, GPR100, RLN3R2, RXFPR4
• Gene name: relaxin family peptide/INSL5 receptor 4
• Alternate names: relaxin-3 receptor 2, G protein-coupled receptor 100, G-protein coupled receptor GPCR142, RLN3 receptor 2, insulin-like peptide INSL5 receptor, relaxin family peptide receptor 4, relaxin/insulin like family peptide receptor 4,
• Gene location: 1q22 (155941637: 155943086)     Exons: 1     NC_000001.11
• Gene summary(Entrez): GPR100 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM, Mar 2008]
• OMIM: 606637

Protein Summary

• Protein general information: Q8TDU9  
  • Name: Relaxin 3 receptor 2 (RLN3 receptor 2) (G protein coupled receptor 100) (G protein coupled receptor GPCR142) (Insulin like peptide INSL5 receptor) (Relaxin family peptide receptor 4)
  • Length: 374  
  • Mass: 41141
  • Tissue specificity: Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon. {ECO
• Sequence:

  MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPP
  SDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPG
  THLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYL
  LLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS
  NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG

• Structural information:
  • Interpro: IPR000248  IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000357301
• Other Databases: GeneCards:  RXFP4  Malacards:  RXFP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000253	positive regulation of feeding behavior	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04926	Relaxin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881